Candidatus Phytoplasma mali uid59087

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194246554|ref|YP_002004193.1| Dihydrolipoamide dehydrogenase [Candidatus Phytoplasma mali]
    MKNYDIVVIGGGPGGYVAAIKASQLGAKVALVEKHKIGGVCLNYGCIPTKTYFKSAKVFKEIKKSSYYGLKIQGDISFNW
    KDILLRKNKVVQKLNNGVEFLLKKNKVDLYYGFAEALTSKTVKIGNDLVINTRKLIISTGASTFIPPIEGLQESYEKGIV
    KTSKELLELEDLPKKIVIIGGGVIAIEFATIFNAFGSEIIILERQSNILNNMDKDIIEGCYKKIKNDGIDVLNNVEVMRI
    KDNKIFYSYNNQNKELIADTILIATGFKPNLSGLEKLNLNIEKNSIVTDNFLRTSLPDVYAVGDVNGRYMLAHVASHEGI
    IAVNHALGKEENANGINYDRIPSCVYSFPEIATIGLTEQEAKLKGMDYKISKLPLTAIGKSLADGETEGFAKLIVGKQNL
    EIIGMHIYAYNATELISEISVAMELEGTAYELANAIHPHPTLSELIFETYLGAIDKPIHM

    >gi|194246600|ref|YP_002004239.1| Arsenate reductase related protein, glutaredoxin family [Candidatus Phytoplasma mali]
    MIRIYTSLSSSSCRKAKNWLDEHRLDYKEFNLNFYKINYFDINFILKNTEYGFTNIISKRSNIYKEKKIDFENLNVVELK
    NIIIKYPSILRTPIIVCDTKIQVGYNSDDIRIFLSRDLKRYFMKNKNYNSFEEYQKLLKFYFYQKK

    >gi|194246635|ref|YP_002004274.1| hypothetical protein ATP_00240 [Candidatus Phytoplasma mali]
    MAFQVTIFYEKKINDFIFIKDNIKNKLTSALIPNNQNQSDPQELFSLSWIICFYKTSQKILLYKGFNDVDIKINLVSNLH
    KDQQGFYFELILKVGIENFSLDDIKVILEEAHQK
    CPISRMINKYNHLKIFPVNYQDILIN

    >gi|194246679|ref|YP_002004318.1| hypothetical protein ATP_00285 [Candidatus Phytoplasma mali]
    MKKIEKYIIILYYKYTKIKNLQCFKNKHLKFCQNLKLLGRIIISHEGINGTLSGKVDNINKYIKIMQENEIFKDIDFKIT
    KYKKNVFNKLSIKIKKEIVNLKLDKDIDMLKIKSNYLNPKEFHENLKNNDNIIIDVRNHYEYQLGHFKNAINPKIKNFRE
    LPLWVENNKNLLKNKKIITY
    CTGGIRCEKFSAFLKSKGFDETYQLKGGIITYGSANLTNDILWNGKLYVFDSRIAIKINN
    KKYKIVGKDNFDNKPCERYINCANPICNKQFFCSKKNEHKFFGSCCYECQISKNNRYIMKNKNIKNTLST

    >gi|194246682|ref|YP_002004321.1| Uncharacterized NAD-dependent dehydrogenase [Candidatus Phytoplasma mali]
    MKVIIIGCTHAGTAAVKTIKKNNPQAKLTIYDKNDNISFLSCGIALYIEGVVKDKNGLFYSNKDELLNMGAEIKLKHEII
    DINLKQKQVLVKDLETNKEFIDNFDKLVLALGSWPIIPQLEGIKSKNVLLSKNFNHANNIIKYIKNINKITIVGAGYIGI
    ELAEALAVQGKKIVLIDAEKRIMPKYLDKEFTDIAEKTLKDHGIHLALNQKITGFDVEGELITKVHTEKSTFETEMLIMC
    IGFRPDTNLIKDKIKVSENGAILINEFMVTSHPDVYACGDCINSYYNPTKEPKYIPLATNAIRTGMIVGLNIKTPKFKYL
    GTQGTSGIKIYDWHIASTGLNENVAKKLGNNYDSVIIKDANRPEFMPKYDAVILKIIFDKISRKILGGQIISKTDLTEKI
    NTLSVCIQKNMTVEELSLVDFFFQPHFNKPLSILNLAGLKALNIK

    >gi|194246719|ref|YP_002004358.1| Thioredoxin [Candidatus Phytoplasma mali]
    MYNYNGINYQTLINQKELVLVDFFAEWCGPCQKLMPILEKVSQIEKDIFFCKVNVDNYRSLVLENKVMSFPTLILYQKGK
    EIKRQIGYCSQNELIKFLT