Candidatus Phytoplasma australiense

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|197294180|ref|YP_001798721.1| Putative regulatory protein spx [Candidatus Phytoplasma australiense]
    MVIFYTSFNCSSCQKAKKWLKQHRIEFIERSLFGHDFQQKDIDLILKYCLHGFDDIISKLSKFFKEQNIDFNNLSTKEVK
    QIIMQKRSILKRPILVEGQKIQIGFNSEGIRIFMPKNLRDFLMKNDVFYKAKDKYKILLKKFFENKNNDEPICK

    >gi|197294639|ref|YP_001799180.1| Rhodanese family protein [Candidatus Phytoplasma australiense]
    MTPTKEYQVILYYQYTKIDDVQLFRDNHFKYCQSLELQGRVIVSQEGINGTLSGTKSNLQTYMQHLKKDHRFSDIVFKID
    QATKHLFPRLSVKVKKEIVNFNFNQELDMDKNKGTYLTPESFYHAMQQKDTLILDARNDYEYDVGHFRNALNPKIKHFRD
    LPEWVEKNVSLLQNQKILTY
    CTGGVRCEKFSSFLKQKGIQEVYQLEGGVISYMQNPQTQGVLWDGQMYVFDQRITIPVNQ
    KEHVIVGKDYFDQTPCERYINCSNPECNKQILCNEENEHKYLGACSKKCRLHPSNRYLLKRNNQQL

    >gi|197294723|ref|YP_001799264.1| Dihydrolipoamide dehydrogenase [Candidatus Phytoplasma australiense]
    MKNYDILIIGGGPGGYVAAIKASQLGAKVALVEDHKLGGICLNYGCIPTKTYLKSAKVYQTIQHAQDFGITLNQPPTFNW
    LAIFNRKNKIVNQLTSGIAFLLKKNKVDVYNGFAVPLSPQKIQVNKEILETEKLIIATGATAFIPPIPGALEAYQKNILK
    TSKELLQLDKHPKNIIIIGGGVIGVEFATIHKSFGAEVTILERQSNILNGSDHDIVNAYTKRLKSDGINVLTEVQINSIQ
    GHKVTYTHQNIQTTQEAEVILMAAGTKPNLAGLEKLDLEKNNNSIVTDEFLQTSIPGVYAIGDVNGKYMLAHVASHEGII
    AVMHALGKGEHGINYNRIPSCIYGFPEIASIGMTEQDAQMKKIDYKVSKVPLSAIGKALADGEKEGFAKIIVDKKHLEII
    GMHIYAYNATELISEIAVGMELEGTAYELAQAIHPHPTLSELTFEALLGAIDKPIHV

    >gi|197294802|ref|YP_001799343.1| Thioredoxin [Candidatus Phytoplasma australiense]
    MLTKKVISYQGQNFSDFINREGLVLVDFFAVWCPPCRKLEPILEEVARVQREVFFAKVDIDLFREVTLEQKVASFPTLIL
    YKNQKEVARNNGFLDKEELLSFLQKHK

    >gi|197294850|ref|YP_001799391.1| Putative NADH oxidase H2O2-forming [Candidatus Phytoplasma australiense]
    MKVIIIGCTHAGTAAAKTIKKTSPQTDIVVYERNDNISFLSCGLALYVGGVVKDSRGLFYSNPEELIHMGINTKLQHDVL
    KIDFEKKEVLVCNLETKQEFKDNYDKLVIAAGSWPVVPPIEGIHSKNVLLSKNFNQAKEIISYSQKVNKITVVGAGYIGV
    ELAEAFALRKKEVVLIDAETRIMPKYLDEEFTDVAQKELTDHGVKLALGQRIVGFETKDGLVTKVKTDKDTFETEMVIMC
    IGFKPNTKLFNQALKTLPNGALIVNEYMQTSNPDVYACGDCVNVYSNPKKITQYIPLATNAVRMGTLVGLNLMKNQVKYL
    GTQGTSGIKIIDLNISSTGLTETVAKELGKNYDTVTIKDANRPEFMPDFETVTLKLVFDKDSRKILGGQIVSRMDLTEKI
    NTLSVCIQNEMTVEQLAFVDFFFQPHFNKPWSLLNLAGLKALEKKI

    >gi|197294229|ref|YP_001798770.1| hypothetical protein PAa_0087 [Candidatus Phytoplasma australiense]
    MIVFQTTTYFNPYLNDLCFFEEKSGTTKKLVSALEPSQGQSGPKDLFCLSWAICLYRTTHKFLDLKGHKNPEIKVKVTLE
    MLKDERGFYFKPTAILAIKGMSLEETETILKTVDYKCPISRLISNDPHVQVKVASYDELITQ