Candidatus Pelagibacter ubique HTCC1062 uid58401

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71082785|ref|YP_265504.1| thioredoxin reductase [Candidatus Pelagibacter ubique HTCC1062]
    MSENPIKHTKVLIIGSGPAGYTAAVYAARAMLNPILVYGVQPGGQLTTTTDVENYPGFSDVIQGPWLMDQMRDQAKAVGT
    DLIEDHISSVNLKSTPFEAIGDSGQKYTADSIIISTGAQARWLNLESEQAYRGFGVSA
    CATCDGFFFKEKVVAVVGGGNA
    AVEEAMFLTKFASKVKLIHRRDTLRAEKLLQKKLMENKKIEIIWDSAVEEVIGDSEPKNVKAIKIKNLKTNKIEEMKIDG
    LFIAIGHDPATALFKEQLEMDKEGYLLTKPDSTETNIPGVYAAGDVKDKTFRQAVTAAGMGCMAALEAEKFLSH

    >gi|71082821|ref|YP_265540.1| DsbA-like protein [Candidatus Pelagibacter ubique HTCC1062]
    MVKRISEGKESAKITIIAYESLTCGHCANFHKDVLPELKKDFIDKGLVKIEFRHFPLDLAAFNASKIAQCNNDGNSNILH
    ILYSGQKKWARGKTPEEATGYLKKFLESESVNLDFEKCLSDKAIEDFVLNDRIDGVKKFEVNATPTIIINDKKFDKALNY
    KNLKKYLEKLI

    >gi|71082835|ref|YP_265554.1| peroxisomal membrane protein a (pmp20) [Candidatus Pelagibacter ubique HTCC1062]
    MKLKENDNIPNSEFFIMEDGNPTKKNTHEFYKDKKIVLFGLPGAYTSVCSAKHLPGYVNNYEKYKEKGIDHIVCISVNDP
    FVMDSWGKSQNVENKIIMMADPFLEFTKAIGADVDKSARGLGIRSNRYTMLIDNLKVIKLQEEEDAGACEISAAQNFLSL
    V

    >gi|71082877|ref|YP_265596.1| rhodanese-related sulfurtransferase [Candidatus Pelagibacter ubique HTCC1062]
    MKKFDELMNVSSEIKNISVDEAKEKLNDPNVQFIDVRDKNSFESETIGNAVNLERGLLEFYLADGSPLENEMFKKNPDKE
    YIVF
    CGLGGQSTLATKTMQDMGIKNVKNMTGGMTAWKDKK

    >gi|71082893|ref|YP_265612.1| peptide methionine sulfoxide reductase [Candidatus Pelagibacter ubique HTCC1062]
    MEIAVLGLGCFWGPEIKFSKLEGVIKTEVGYCGGDSKTVTYKEVCTCNTNHAEVVKLDFDPKIISYEKILNFFFEIHDPT
    TLNSQGPDFGTQYRSEIFYLSDRQKEIAESVIKKVNLKLSGNVVTKSSLLKNYCPAEEYHQRYLEKR

    >gi|71082894|ref|YP_265613.1| thiosulfate sulfurtransferase [Candidatus Pelagibacter ubique HTCC1062]
    MSLVDTNWLEKNFDKVKIIDCSWHMPQTERNGFDEYKNIHIKNAIFFDLDKNSKKDTDLPHMLTDAKSWENIVSSMGIKN
    DDQIVIYDNSDVISSCRCWYNFIYFGHNPELIHVLDGGLKKWIKEDKATTSDIIKIIPTNYIANEKRELVKDINQINKNI
    LENDFNVIDARSLERFEGKVPEPRKGLRSGSIKNSFCLPFSELINEDHTFVSKEKILEKFKSTGYEMGKNIVFT
    CGSGVT
    ASVLALAYSLIDNKYMPNIYDGSWSEYGKN

    >gi|71082940|ref|YP_265659.1| dihydrolipoyl dehydrogenase [Candidatus Pelagibacter ubique HTCC1062]
    MSDKFQAVVIGGGPGGYVCAIRLAQLGLKTACIESRGSLGGTCLNVGCIPSKNLLNISENYHKAQNFSKLGIEVGEVKLN
    LQKMMQNKDKAVTILTKGVEFLFKKNKVTYFKGTGSFKSANKISILDDQKKETIIETDKTVISTGSVPVALPGIEFDEKI
    IVSSTGALTLETVPKKMVVVGGGYIGLEMGSVWSRLGAEVHVVEFLEHITPSMDREISTEFMKILKKQGINFHMQTKVEG
    IKKNANGAIVSTSDKDGKKADFDCDVVLISVGRKPNTTNLNLEAIGVELDEKKRIKTDKTFQTNVKNVYAIGDVIDGPML
    AHKAEDEGIAVAENIAGQSGHVNYDIIPGVVYTTPEVASIGKTEEQLKEANTKYKIGKFSFMANSRAKAIDEAEGFVKIL
    ADEKTDRVLGAHIIGPHAGELIGEIGVAMEFGASAEDIARTCHAHPTFSEAVKEAALSVDKRAIHS

    >gi|71082988|ref|YP_265707.1| cytochrome C biogenesis protein ccmG [Candidatus Pelagibacter ubique HTCC1062]
    MKNKFSLFVVVIFLSFCFVIFYKGLNTPNNYTPKVNEKKNIPTFKAKDFYSNNYVNSEKIFEENIFYIVNIWASWCVPCR
    TEHPLLMQLSKNQSIKLIGLNYRDNFNNAKKFINDLGNPYSRILIDKDGTLGVEFGAYGVPETFLIDKNKDIIKKFVGPI
    NQEIVSEIKLIIK

    >gi|71083000|ref|YP_265719.1| polyketide biosynthesis dithiol-disulfide isomerase [Candidatus Pelagibacter ubique HTCC1062]
    MKIKVFADTICGWCFIGQTRLNKALKNFPETKFEIEHVPFQLNTDMPKEGIERNKYLEIKFGGKEFAQPMYDRMTEEANK
    ENLNFNLDKIKKTPNTVFSHLLIKLAEQSNVHNEIKEKIYQSYFIEGLDIGDKEILINIGKEFNINGDTINDFFNLKNIE
    EINSYILVAREKEINGVPFFEIGTDFISGAQSSANLESVIKSNLS

    >gi|71083108|ref|YP_265827.1| molybdopterin biosynthesis protein [Candidatus Pelagibacter ubique HTCC1062]
    MNSQLKKASIERYSRQIVLKDIGTIGQKKIISSKVLIVGMGGLGSPVAEFLARAGVGSIGIVDDDKVSLSNLHRQSLYNT
    SDIEKFKVQVARVKIKKINPSIKIKIYKIRLDKNNFKKIIKDYDYIVDGSDNFSTKFLLNDFCYKFKKILVTGAISKFDG
    HIFTFNFKNKKIPCLRCFFQDSDISDDLLN
    CESEGILGTVAGIIGTIQANEVLKKILGIGKSLDGYIFILDLLQLNFRKV
    KLKKRKNCFCK

    >gi|71083121|ref|YP_265840.1| thiol:disulfide interchange protein [Candidatus Pelagibacter ubique HTCC1062]
    MKLLLIFIYLITSNISYALEKPNIKNLVLSKNTKIYEGVVFKDSNNYDVNLDDFKGKLLILNFWATWCAPCREEMPSLDD
    LQSNSNFDNLKIFPINIGQENFSKSDSFFRELNIQNLEIYFDAPITLAKKFSLRGVPTTILFNKKGEEFGRIMGSIDFNN
    LDFINWLKQYD

    >gi|71083190|ref|YP_265909.1| thioredoxin 1 [Candidatus Pelagibacter ubique HTCC1062]
    MLIDFKDEEFETKIKNEDISVVQFSAEWCAPCKSLKPIMDKFSDSYKDKANFYYADIENGGINTGSAAGVRGVPTVIVYK
    KGVEVDRKVGGVAESQMKEFLDKNI

    >gi|71083332|ref|YP_266051.1| thioredoxin-disulfide reductase [Candidatus Pelagibacter ubique HTCC1062]
    MIKTDALIIGAGPTGLFCAHQLGLIGLNCEIVDNLDKIGGQCIELYPDKPIYDIPAVPECTGEELTNNLIKQIKPFNIKF
    HLNERVEEVNKVNNKWIVKTNKKKEFVTPNIIIAGGVGSFEPRKFSPKECEKYENRSLFYSIKDKTIFQDKTISIFGGGD
    SALDWAIELSKSSYVNLIHRRDEFTGAQLSIDKIKELEKSGKLKIYTKYQLNSVKGEQNIKSIEIKHDDESLKELETNYV
    LGFFGLIMKLGPIVDWGLNLDKKTIPVNTENFETNLNGIFAIGDICTYPGKLKLILSGFHEGALAARGCFKYARPDEKLR
    FEFTTTSKAAQERLGVKK

    >gi|71083381|ref|YP_266100.1| hypothetical protein SAR11_0678 [Candidatus Pelagibacter ubique HTCC1062]
    MTIGWHFDNSYSRLPKTFKENINPVAVNAPEILILNKDLANKLDLDFSNINDDDLSKIFSGNLLPEGSNSIAQAYAGHQF
    GHFTMLGDGRAVLIGEHLTKNNERFDIQFKGSGRTPFSRSGDGRAVLGPMLREYIISEAMHFLKIPTTRSLAVVKTGEDV
    VREQISQGAILTRVALGHLRVGTFQYIAAKQNISDLEILINYTIEKYYPNIKSSKNKALDLLNVLIEKQTQLVIDWMRVG
    FIHGVMNTDNMSISGETIDYGPCAFMDVYDPKTVFSSIDQLGRYAYENQPKITKWNLTRFAECLIPLISTNEDEAIKLAT
    EALDKFEQNYETKWLNMMRDKLGLYGEDKEDKNLIMELLNWMKEKKADYTNTFIFLMNKTIKNSEVYDNADFDLWKTKWM
    KRLVMFGNTHDKSVDLMSSCNPMVIPRNHKIEEALMLANNGDLTLFNKLIKILKNPYLVNNGDLELMSPAPHSDEKYQTF
    CGT

    >gi|71083448|ref|YP_266167.1| hesB protein [Candidatus Pelagibacter ubique HTCC1062]
    MNPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYAKEINLSDEIIEDKGVKVFVDAAAVMYLLGTEM
    DYKKEEFSSSFVFNNPNESERCGCGESFKV

    >gi|71083520|ref|YP_266239.1| bacterioferritin comigratory protein [Candidatus Pelagibacter ubique HTCC1062]
    MFKINSKAPLFKLNSTDGEIYSLKDSLGKYVVLYFYPKDDTPGCTIETNDFNKLLPKFKKLNCEIFGISKDDLKSHHKFK
    EKFKIKFDLLSDVELNILKKYKVWAKKKFMGREFMGIVRTTFLIDPNGKIVKIWDNVKVKDHAKEVFDTLKNSIN

    >gi|71083522|ref|YP_266241.1| sulfide dehydrogenase [Candidatus Pelagibacter ubique HTCC1062]
    MNIKSSHTLVAEALREIKTISPEQALKLSNENKCSLIDIREKGELDKSGRVENSHHIPRGMLEFWLDPESPYFKNGKLDM
    EKEIVLF
    CAGGLRSALAAKSLKEMGFENVSHIEGGFAAISQSDFKIV

    >gi|71083660|ref|YP_266380.1| HesB-like domain-containing protein [Candidatus Pelagibacter ubique HTCC1062]
    MIKEIKFTDKAIKQINNLLSQKDPGSFFRIAIKGGGCSGFQYEFTFDKKLEADDLKHENILIDKTSADLLKGSEVDFVSE
    LIGDQFKITNPQSKSSCGCGVSFSI

    >gi|71083695|ref|YP_266415.1| glutathione peroxidase [Candidatus Pelagibacter ubique HTCC1062]
    MFTFFEKVDAKYEKLFFDHSIKNINNETIDLNQYKGKTILLVNVASKCGFTKQYTGLQELYEKYKDRGFYVIGVPSNQFG
    GQEPGTNSEIKDFCETNFNITFPITDKTDVKGNNAHDLYKWAKKNYGNSTVPKWNFHKILINKEGKIQDTFNSFITPMSD
    KITKQIDLIL

    >gi|71083712|ref|YP_266432.1| 6-O-methylguanine DNA methyltransferase [Candidatus Pelagibacter ubique HTCC1062]
    MNSMNLKGTKLQLKVWNYLKKIPKGKVKTYLEVAKAIGKPKAFRAVANAVGKNPYPTKIPCHRVIRSDGSLGGYSGKGGI
    QQKRRLLRSEKVFIK

    >gi|71083762|ref|YP_266482.1| rhodanese domain-containing protein [Candidatus Pelagibacter ubique HTCC1062]
    MFDVFGFYKFKKLTSLKKNKILLQDYLIKKNIRGTIIIANEGVNATISGKANDLKSTITKIKKILNFKKFDSENISKSKF
    QPFHKPKVKIKKEVVPMGLSLSSKNKKNNHIDPKKWNKLINDKDTLVLDSRKPFEYNVGTFKRSVNPDVANFREFPKYLN
    KLKKTKPIAMF
    CTGGIRCEKASVFLEKKGFKNVYQLKGGILNYLKNIKKKESLWNGECFVFDNRISVKHGLITGTYSMCS
    GCRKPVSPKDKKSKKYEEGVSCVNCHDNLTQTQKERFRMRQKQINLAKKTGSKHIFQKEFK

    >gi|71083830|ref|YP_266550.1| glutaredoxin [Candidatus Pelagibacter ubique HTCC1062]
    MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWPTIPQVYIKGE
    FVGGCDIVKEMYENGELKKVLEDKGINFKK

    >gi|71083860|ref|YP_266580.1| OsmC-like protein [Candidatus Pelagibacter ubique HTCC1062]
    MSNNLKETISNLQKDFTANPKNAVVQYESNSILKEGLQSVVTLREHKLVVDEPKSFGGKDEGPSPVELILAALATCQEIT
    YKAFATAAGINIESVSVKLKGELDLQGFLALNKNTRPGFQSISGTVDIKSSSPKAEIDKLIDTVNTH
    CPVLDILSKGVPI
    KLFQKVSSNSYNEEHIEQRVSAA

    >gi|71083890|ref|YP_266610.1| hypothetical protein SAR11_1199 [Candidatus Pelagibacter ubique HTCC1062]
    MPLKTPICDFGQAAKSFELKSTNNEIIKLNDVKGTNGTLVMFICNHCPYVKAIIKDIVEDCKNLEKHGVKAVAISANDPI
    NYPEDSFENMIEFARKHQFNFPYLFDETQNVAKSYDAVCTPDFFGYNNNLELQYRGRIRELDNLKPVRAGDSDLFTAMKQ
    IAETGKGPETQIPSVGCSIKWLDN

    >gi|71083916|ref|YP_266636.1| ADP-ribosylglycohydrolase [Candidatus Pelagibacter ubique HTCC1062]
    MFKKLHIFLGATVADAAARPLHWVYDEKKLKSYIKGKKNIAFFKQNRSPFYSIKTGEVSGYNDVGQVMFKTLTKTTNHKE
    VIKLFKKNIVKNFGPGSKYWKNLSLRKKYKKIKWKTAMKGPWIHQNILETIKNIKLKKTITGGTKVNESDGYCASLPFYF
    SNNSDHKTKQIIRTVANGKISEQFALAKLKIIDLADKGDKDPVNSFLRKNIKNKYFKNVIENIKKVKKVKSKPHNFVVKK
    FGKA
    CSYPGTFNGGIHAIITSKSFKTAVIKTIKAGGCNCSRANFVGAYFAAYKGLKGIPQDWIKKTNPAKSILKFIA

    >gi|71083918|ref|YP_266638.1| hydroxyacylglutathione hydrolase [Candidatus Pelagibacter ubique HTCC1062]
    MLFRQLFDKASSTFTYLIASAKGREALIIDPVLENVEQYIKLLKELDLKLVKVIDTHIHADHISGIAELRDKTNCVTVMG
    DKTPADVVAMQVADEETIKIDGLELQAIYTPGHTIESFSFLMNDRVFTGDALLIRGTGRTDFQNGNARDSYNSIFNKLLK
    LPDETLIYPAHDYKGEMVSTIIEEKKFNPRLQVSSADQYIEIMNNLNLPNPSMMDVAVPSNLQLGIDFNRQKVNNGVEPE
    KFNEIKNDAQSILIDLREQNEIDKDGMIKNSTVVRFPEINEYLQQNKNTLKDKRILFY
    CAHGHRSTLAVQLSKSYQFTNC
    FHLIGGLKNWKKEGLDL

    >gi|71083920|ref|YP_266640.1| thioredoxin [Candidatus Pelagibacter ubique HTCC1062]
    MKKILILIFILLSFNSFAVEKNTTFNNEIFQKAQLDGKIVVINSWNETCTTCKVQIKILNQAEKDFEDILFLSFEQEKDK
    TIAKQLGIDYWTTIVIYQNNKEVYRSIGQMNKDKIYSAIKSL

    >gi|71084051|ref|YP_266771.1| glutaredoxin [Candidatus Pelagibacter ubique HTCC1062]
    MKNVTIYTGPLCNFCDAAKRLLARNNVEYKEINIATVDGAMDEMITKANGKRTIPQIFFDDNHIGGYDDVRALEKENKLL
    ELLK

    >gi|71084052|ref|YP_266772.1| SelR domain-containing protein [Candidatus Pelagibacter ubique HTCC1062]
    MTKKINKDLTAEQKLVLFEDGTEAPGTSELNHEKREGSYHCANCGEKLFDSNAKYESGSGWPSFYQSLPDAFETKTDTLL
    GYERVEYHCKKCGGHHGHIFEDGPKPTGKRY
    CNNGVCLTFKPKN