Candidatus Nitrospira defluvii uid51175

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302035405|ref|YP_003795727.1| putative thiol oxidoreductase [Candidatus Nitrospira defluvii]
    MTGQALTVDVYSDVVCPWCYIGKRRLEQALESVQAQATARIFWRPFQLNPTMPKAGMDRRVYLETKFGGPGEMKAIQDRV
    AAVGTSVGIEFAFDRIARTPNTFDAHRLIWFAQQQGRQDEVVEELFHGYFTEGLHIGQAEVLVSLAVRAGLDGEAVGRLL
    QAQEGEDAVRQEEAHGHQLGIRGVPYFVLNGTAALSGAQPVETFVSAIKQVAG

    >gi|302035438|ref|YP_003795760.1| peroxiredoxin [Candidatus Nitrospira defluvii]
    MKRHASAQWNGDLKTGKGTVSTQSGILSQTQYSFATRFENGNGTNPEELIAAAHAGCFSMALSGQLGAANLVADQLATTA
    TVTMEKIEAGWTVTGVHLSVTGKVPKADAAAWEKATAAAKAG
    CPISRLLNTTITMDAKLEH

    >gi|302035453|ref|YP_003795775.1| hypothetical protein NIDE0059 [Candidatus Nitrospira defluvii]
    MNTFQFLADHGAWVLFWVVFIEQLGFPIPAIPLLVAAGALVGAGKMSLATALLLPVAAALPPDLAWYYLGRIKGGRVLGF
    LCRLSLEPDSCVRDTENLFHRYGPRGLLLAKFIPGFNTVAPPLAGIVGMAATTFALYDVAGTFIWAAVSAGVGAVFSNQL
    EQLVGLFDQAGGLVFGVLLIGLAGFIGYKFYYRQQFLRHLRMSKISVDELKQRLDAGEAISVVDVRHPLSLQLDPDTIPG
    AINFTLEEIEHRHHEIPRDRDIVLYCT
    CPNEVSSARTAFLLKKKGIHRVRPLEGGLDAWRERQYPVERRMNAGVSG

    >gi|302035459|ref|YP_003795781.1| mercury ion transport protein [Candidatus Nitrospira defluvii]
    MKPDSPTEPQSGSGRGALLTGGLAAILASTCCLGPLVLITLGVSGAWISNLTLLEPYQPFFIGAALVALLFAYRRIWRPV
    AACEPGQVCALPQANRSYKALFWIVVALVIAALGFPLIAPWFY

    >gi|302035460|ref|YP_003795782.1| periplasmic mercury ion binding protein [Candidatus Nitrospira defluvii]
    MKKLVALAALAAMTSPVWAATQSVTLSVPGMNCATCPITVKKALTKVSGVSKIDVSLDRREARVTFDDAKANVEALTRAT
    KDAGFPSTLVGAAK

    >gi|302035548|ref|YP_003795870.1| 4-carboxymuconolactone decarboxylase [Candidatus Nitrospira defluvii]
    MDCYYHSNDLGKFGDMGKGNPVLWEKFMSYYSAVFAEGALTEREKVLIALGVAHAVQCPYCIDAYTQACLEKGSNTEEMT
    EAVHVACAIRGGASLVHGVQMRNVAEKLSM

    >gi|302035607|ref|YP_003795929.1| Rhodanese-like sulphurtransferase [Candidatus Nitrospira defluvii]
    MRYLSGLLCVGVLCGLLLEWPQPTFAYHSYTLTVQQLRAGLLKAPSTGAKGFLLVDVRSSEEHASGMIPGTDRNIDFREM
    KTRHRELGAALNDHIVVY
    CQSGHRSNIAAETLADLGYTHVYNVVGSMNAWTEAGFPVSPGR

    >gi|302035848|ref|YP_003796170.1| methionine sulfoxide reductase A [Candidatus Nitrospira defluvii]
    MGQETMDIATLAGGCFWCLEAVYDQVKGVQSVESGYIGGQVDAPTYEQVCSGHTGHAEAVRITFDPRLVTFRDLLNVFFV
    IHDPTTRNRQGNDIGTQYRSGIFYHSPEQQQIAQEVMAAVTREGVYPNPIVTEVVPASQWYEAEAYHQEYFARNPFEGYC
    AYVVGPKVAKFRQRYASLLKA

    >gi|302036005|ref|YP_003796327.1| thiol-disulfide oxidoreductase [Candidatus Nitrospira defluvii]
    MDTQSRACRKSTNVTQGLTRKLVVTVLLLSTLVGSALAMGSRPPAAGMPASGFSLTDLHGKTHSLEQYRGKIVLVNFWAT
    W
    CKPCTSEMPAMQTVYEQLRDKDFVVLAVNELEDEAKVREHIQQYQHTFPVLLDRENQVANQYGVFGLPVSVFIDQQGVV
    QEYIKGGLLTERKIQEIVNRIQNAVPITAASLR

    >gi|302036009|ref|YP_003796331.1| putative thiol-disulfide oxidoreductase [Candidatus Nitrospira defluvii]
    MMTTGLFRGLMLAVVLSATAGPAWADDPFAALKIARVAPGTAAAAFELPSLDGRMVQLADLKGKVVVVNFWATWCGPCKE
    EMPAFERLRQQLDPNRFALLTVTTDLQREGIKHFLANLHVLVPVLFDEDQAVSQAYLVRALPTTVFIDRQGALIGRAVGP
    REWDTPKAVQAIQSLMP

    >gi|302036051|ref|YP_003796373.1| putative disulfide oxidoreductase dsbA [Candidatus Nitrospira defluvii]
    MAKRRGWRGSLLMGLMAVAALGFVGTAQAGKAELKGNFQVLSDEKSTHKPGKVQLTEFADFYCPHCHRFDGEGLAILEKE
    FGNKLEAVMVGYPVIPGKLPTAFDMYEQAKTMGKGAEMKRALFRTIHKDKIGIIDKAIREVLIREVGLDPAAFEEGLASA
    KPAKAFEDGRKWGDRIKIQQTPTVLLDGNIKVEQIDPENLKLIIHSILDGDGKK

    >gi|302036219|ref|YP_003796541.1| thiol-disulfide oxidoreductase ResA [Candidatus Nitrospira defluvii]
    MTDHINQSPAHTAPRTGPSRIVVVIAAAAILGVMFLVVWLQSSKYEPLVVGKEAPDFQLPDLNEKQLRLSDYRGKVVFLN
    FWATW
    CKPCREEMPSMEVLYKNFEKDGLVILAVSIDRVTTKKEIPPFVKGLNLTFPVLVDSWGQTDKRYKLMGVPETYII
    DQQGVLREKVIGPRDWTRLDNLKVLTQLLKPAEKAAHATPAQALPMM

    >gi|302036220|ref|YP_003796542.1| thiol-disulfide oxidoreductase ResA [Candidatus Nitrospira defluvii]
    MVGAVMMLCGGVSADAREALPASPAVPMLVVERIPQVDEEAPNFLLRDSEGFNVTLDQFRGKVVLLNFWATWCGPCKIEM
    PAMERLYRSFSRKDFEILAVSTDAQGAAVTRPFQREVGFTFPVLHDADFRIGLQYGARQLPMTFLIDRKGIIRNRIPGAR
    DWSAPAGKRLVESLLQGS

    >gi|302036253|ref|YP_003796575.1| hypothetical protein NIDE0884 [Candidatus Nitrospira defluvii]
    MPVELSRKKCTTDAADLEREAARIRDAYARRTTGSCAGLYSFFNRGNLFLLQERERRVLSVLERAGWSSLQAVRILDVGC
    GAGFWIRDLIRWGADPRHITGVDLLEQRVEEARCLSPEGVTIHCRNAAALEFPDESFDLIIQSTVFTSILNRDVQQRLAR
    EMVRVLRPNGLILWYDFHMNNPRNPDVRGVTAREIHRLFGD
    CTIELSRITLAPPVTRMLAPLSWFACQLLSAVPWLCTHY
    LGTIRKSARYE

    >gi|302036426|ref|YP_003796748.1| putative thiazole biosynthesis enzyme [Candidatus Nitrospira defluvii]
    MGKPKPAPLRERDITRQIAREYYKEFDQLIESDVIIVGAGPSGLICAHDLGRMGIKTLIVEQSLALGGGFWSGGYLMNKA
    TI
    CAPAHKILKEVGVPCKQIKECPGMYMVDPPHATGALIAAAYNAGAKIMNLTRVVDLILRREGVLEGVVVNSTTAEMAG
    HDIIHVDPIALESKIVVDATGHDAVVVNLLHKRGLYQQVPGNGAMWVSRSEEEVMDRTGEVSPNCFVIGLAVAAVFGTPR
    MGPAFGSMLLSGRYGAELIRDKLKNR

    >gi|302036490|ref|YP_003796812.1| thioredoxin-disulfide reductase [Candidatus Nitrospira defluvii]
    MHDVVIIGSGPAGLTAAIYAARANLSPLLIEGWQSGGQLTTTTEVENYPGFSKGIMGPELMKEMRAQAERFGTEFLTGDV
    SAVDLAQRPFRLTIDGDQTVEAATLILATGASAIALGLPNESRLIGHGVST
    CATCDGYFFRGKDLLVVGGGDSALEEANF
    LTKFARTVTVVHRRDKLRASKIMQDRAMKNEKISFAWNSVVEDILGTDLVTGARLKNLVTGAASELACDGVFVAIGHRPN
    TDLFKGQLAMDEKGYLLTSQGTATSVAGVFAAGDVQDTKYRQAITAAGSGCMAAIDAERFLEHQ

    >gi|302036508|ref|YP_003796830.1| putative mercuric reductase [Candidatus Nitrospira defluvii]
    MSAPVQSLVLPDDEHNRALVANVHPPDWMNPEPVGRYNMVVVGAGTAGLITAVVAAGLGAKVALIERHLMGGDCLNVGCV
    PSKALIRAAHAWAQLRDASAFGLHIPPGVTRDFGAVMARMRKLRAGISHVDSAHRYTSLGVDVYIGQARFTGRDAVSVEG
    PSGNRALTFVNAAVCTGARASAPAIPGLAEAGYLTNETVFSLTELPARLAVIGAGPIGCELAQAFARFGSEVSLIEAMHG
    IMPNEDRDAAEVVQQSMTRDGVRLLCCGKNLKVERTAAGKRLLVDSHGRHYDVTVDDILVGVGRTPNVDGLGLESIGVEY
    DKTGVKVNDRLQTTNPRIYAAGDICSRYKFTHAADAMAQIVIQNALFPHPFGLGYASMDSLIMPWCTFTEPEIAHVGLYE
    ADANKKGLEIETYTYKLGEVDRAILDGEEEGFARIHIQKGTDTILGATIVAARAGDLIGEFSVAMKAGVGAKTIAATIHP
    YPTRAEVNKKVVNLWRKAHFTARTKMLLTRLFAWLRR

    >gi|302036562|ref|YP_003796884.1| soluble pyridine nucleotide transhydrogenase [Candidatus Nitrospira defluvii]
    MAHYDLLVIGTGPAGQKAAIQAAKLGKKVGIVERKRVVGGVCTNTGTIPSKSLREAALYLSGFHQRSLYGASYRVKQDIT
    MEDLTFRANHVINREIEIIQNQMTRNNVDLWFGTAAFVDPHRLRIERSDDLVEHTADFVVIACGTVPARPSHIPFDDHSI
    IDTDGLLTLKTLPKSITIIGGGVIGAEYASILATMGIHVTLIERRPRLLEFVDQETIEALQYHMRSIGVTLRFNEEVVSV
    ERQPQEQVIVRLKSGKEIAATTVLYSVGRTGASATLNLETIGLVADDRGRLTVNEHYQTTVPHIYAAGDIIGFPALASTS
    MQQGRHAACHAFGIPCQTQSELMPYGIYSIPEISMVGRNEDDLTKNGVPYAVGIARYREIARGQIIGDELGMLKLLFHNK
    TRQLLGVHAIGDGATELIHIGQTVMAYQGQIDYFIEAVFNYPTLAECYRVAALDGINQLPRPWPPRT

    >gi|302036563|ref|YP_003796885.1| putative thiol peroxidase [Candidatus Nitrospira defluvii]
    MASPHTRMIPGASASHFLAALLCLSLSGCGTLPGPGHSDFSYKNMPVADGSAAAGEGNNVLFQGKPLMLSGMGIKVGDKL
    RDVKLTQTDLSMVPINDTKGKGKVRIISIVPSLDTKV
    CEQQTHYLSEKNMGLDRMVELITISIDTPFAQKRFAEEAKITN
    VTFLSDFRAADFGKAHGLLLKDPHLLSRALLVVDKDNKVRYLQITPELAQLPDLEEAFRFARKLVTAS

    >gi|302036595|ref|YP_003796917.1| putative glutathione peroxidase [Candidatus Nitrospira defluvii]
    MAAKAATVYDFTLNDIDGKPVSLSQYKGKVIMLVNTASFCGNTPQYSDLEKMYETYKDKGFEILAFPANNFGQQEPGTNE
    EIKGFCLTKYSVGFPLFSKISVKGSDKHPLYRYLTEQSPFPGEVEWNFQKYLVDRSGNVVARYHHRTKPVADEVVKDVER
    FLTKQ

    >gi|302036752|ref|YP_003797074.1| putative thiol:disulfide interchange protein DsbE [Candidatus Nitrospira defluvii]
    MKRVLIAVAIVLVHLWAVHHVVAAGFFKVGEPAPAFSLTSVTGDAVSLEQLKGKVVVLGLFHICDPCMTQGTNLQKVHEA
    MAGKNVAVVGVNSSGDSKRGVGEFLSAFPVKVTYPYLLDPNKTTDKLYGGGKFIPNVYVIDQRGVIRWQRVGNMELAGAE
    VIIQEVEKLLTAATPAGAGAM

    >gi|302036806|ref|YP_003797128.1| iron-sulfur cluster insertion protein ErpA [Candidatus Nitrospira defluvii]
    MITITATAEEKIRELMLEEKDTLGLRVYVKGGGCHGYQYGMAFESKMSDDDTVIEKGDVKVIMDSQSAPLLSGCEVDYVD
    SVQGSGFAIKNPQAKTTCGCGSSFSA

    >gi|302036864|ref|YP_003797186.1| ABC transporter periplasmic-binding protein [Candidatus Nitrospira defluvii]
    MRICSLVPGATEVVAALGRQDDLIGISHECDFPPSLAQIPVMVRPRIESHHLSSVEIDQQVGALVAAEAGLYELDETRLL
    AARPDLIIAQNLCDV
    CAITPLQLERVVQALSPPPRMLTLSPGRLEDILRDIETIGTAIGREEAGIQLSAALRRRLNTVRA
    TVGAPAMRPRVACIEWLSPLYTAGHWVPDMVAAAGGIDVLAQAGTVSRTMDWDTLAASEPDVIVLMPCGFTVPRTKAELA
    SLTAHPQWRHLCAVQRGEIYLVDALSYFSRPGPRLIDGVEQLAAIFHPASYGRHLPASVERLEGQTTHSH

    >gi|302036920|ref|YP_003797242.1| thioredoxin [Candidatus Nitrospira defluvii]
    MAGDALKATDATWDEDVMKASELVMVDFWAVWCGPCQMVAPIVDELATEYAGKVKVRKLNTDENPEIAGRYQVMSIPTIL
    FFKNGQAVERLVGARPKRQFKEIIDSLLAQHSGAA

    >gi|302036934|ref|YP_003797256.1| peroxiredoxin [Candidatus Nitrospira defluvii]
    MADELDVGAKAPDFSLPDQDGSTVTLKGLKGKQVVLYFYPKDDTSGCTKEACDFRDSLAPIKKAGAVVLGVSKDGKASHQ
    KFIAKYGLPFALLSDEEAEVCKAYGVYKEKSMYGRKYLGIERSTFVIDATGRIKALFRKVKVPGHVDEVLAALKA

    >gi|302037088|ref|YP_003797410.1| hypothetical protein NIDE1753 [Candidatus Nitrospira defluvii]
    MAVESFMLSLGTSAPPFTLRDVVTGEVYQLDSFAGSSALLVMFICRHCPYVVHVEQEIARIGRDYRDTGLGIIAISSNDA
    KSYPDDAPPRLKEMAERLALTFPFCCDDTQEVAKAYRAVCTPDLFLFDRQRRLVYRGQLDDSRPGNNRPVTGRDLRAAID
    AVMGGTPVNPDQKPSVGCSIKWKPGNAPAFA

    >gi|302037148|ref|YP_003797470.1| molybdopterin biosynthesis protein MoeB [Candidatus Nitrospira defluvii]
    MEFTEQQIQRYSRHIILNEVGGKGQVKLSKAKVLLIGAGGLGSPAALYLAAAGIGTIGLVDGDVVDLSNLQRQILHTTAT
    IGAPKVESGRRMLSAINPDITIKTYQLNVDTENILGLVSDYDIVLDGSDNFTTRFLVNDACFFAKKTLISASMFRFEGQL
    TSIKPHAGYPCYRCLYPEPPPAGLVPN
    CQEAGVLGVLAGTMGILQASEAIKEILGIGETIADKLVIYDALEMKFRKVSRP
    KDPRCPLCSATPTIKDLGGDYSVACTI

    >gi|302037152|ref|YP_003797474.1| adenylyltransferase ThiF [Candidatus Nitrospira defluvii]
    MEFTETQINRYSRHILLPEVGGKGQKKIVQAKVLIVGAGGLGSPAALYLAAAGIGTIGLIDSDVVDLSNLQRQVIHQTPD
    VGRPKVVSGKEKIQALNPDVNVVMYEERLTAGNALKIMSGYDVVIDGVDNFPTKFLINDACFFAGKPLVHGGILRFDGRV
    TTIIPKKSACYRCVFKKPPPEGLVAS
    CQEAGVIGVLAGIIGTIQATEALKLILGIGRPLTDRLLDFDARRTQFREIRIKR
    NPDCPLCGERPTITELIEDGDVAGPTCALPGQRNL

    >gi|302037205|ref|YP_003797527.1| putative peroxiredoxin [Candidatus Nitrospira defluvii]
    MGLRLGDDAPNFTAETTEGTINFHEWLGGGWGILFSHPKDYTPVCTTELGYMARIKGEFDKRGVKILAISVDPLDSHRGW
    TKDINETQNCTVSYPIIADPEKKVADLYDMIHPNSLDSMTVRSVFVIGPDKKIKLMLTYPASCGRNFDELLRVVDSLQLT
    AKYKVATPVNWKDGQDCIITPAVNDAEAKTLFPKGFKAIKPYLRLTPQPNK

    >gi|302037218|ref|YP_003797540.1| methionine sulfoxide reductase [Candidatus Nitrospira defluvii]
    MPSKIEIGPIVKVTRTDEEWKKLLSLAAYQVLRHEDTERAFTSPLHENHQAGLYYCAGCDLPAYSSEHKFDSGTGWPSFW
    QPIDPKVVEKRTDSRFFMTRVEVHCARCGGHQGHVFDDGPRPTGLRY
    CINGVSLKFVPA

    >gi|302037407|ref|YP_003797729.1| putative thioredoxin [Candidatus Nitrospira defluvii]
    MPNITLLHSPTCGACPSAKRLWKELRVKYSFSYREVDITTPDGQELANRHSVRAVPATIIDGRLTFVGVPPRQSAEKALQ
    LRMKPQGA

    >gi|302037453|ref|YP_003797775.1| hypothetical protein NIDE2130 [Candidatus Nitrospira defluvii]
    MYQVHSKESAPEASRATMEAMEKKYGFVPNLIGVLAESPAAVQAYAAIAAALEHSALSAVEQQVVTLTVSAANDCAYCVG
    AHSTVAKMVRMPEDVLAALRDQRPLSDKKLEALRTLVLSVLRHRGWVPEDELEQAAEAGYTQRYVLDVLTIVTLKTLSNY
    VNHIAHTPLDLQFAPQAWKAPTAPVG

    >gi|302037514|ref|YP_003797836.1| putative thiosulfate sulfurtransferase glpE [Candidatus Nitrospira defluvii]
    MHECTVADVKARLDRAERFHFVDVREDDEYMQDHAAGAIHLGKGVIERDIETVLPNKQEPIVLYCGGGYRSVLAADSIRL
    MGYTNVISMDGGIKAWRAAGYPIEKGRRP

    >gi|302037521|ref|YP_003797843.1| thioredoxin [Candidatus Nitrospira defluvii]
    MIRDVTDRDFPREVEQASMPVLVEFWQPGCGHCLALLTQLEQLQEEVAPVLKIVKMNVQENFQIPAELEIRSLPALALFE
    RGEFVRFIGGIGRKDEIRKQLNLT

    >gi|302037753|ref|YP_003798075.1| hypothetical protein NIDE2440 [Candidatus Nitrospira defluvii]
    MTSTTPGREPNRLIRQTSPYLLQHAYNPVDWYPWGPEALAQAAKLNRPILLSIGYSSCHWCHVMERESFENEAIARLMNH
    HFVCIKVDREERPDLDEIYMQATLALNRNQGGWPMTVFLTPDQKPFFAGTYFPPEDRWGRPGFPTLLKKIAEYWEKDHAG
    VVAQAATLTARLQDGSHAPSPTTVGEAELDMAVTQFAEDFDAKLGGFGGAPKFPPATGLSLLLHCYHRTKDPQTLTMVRT
    TLDAMAAGGIYDQIGDGFARYSTDDRWLVPHFEKMLYDNALLARVYVEAFQVTADPNYRRVACETLDYILKEMTSPEGGF
    YSATDADSEGVEGKFFVWTPDEIRAVLSNEEDVRRICTYYDVTPAGNWEHKNVLHTAKPVASVAKELGLTVEDLQATIDR
    VKPLLYAARAKRVPPGLDDKVITAWNGMMISAMAEAGRVFDMPRYRAAAERACEFLLTTLSKPDGRLLRTYRAGTAHLDA
    YLEDYAYFAEGLIDTYEAGGHERYLSAAVRLAERILADFSDGQQGGFFTTATGHEALIVRSREGPDGATPSGNAVAAAAL
    ARLSYHFGREDFRQAAAGAVRAYGRQIARYPRAFAKSLIVVDLLTSGPVEIAVIGAPDDSNTVALRAAVSRTYIPNRVIA
    SRESQQSEPTHPLLHGKALVGGKSALYVCRNFACRRPITDPADLPTQLDPSHKAAPPLTASEQKVLSGNVYPGAATVQGT
    AGYAARKIHDATGAGSLANGFGPFGATGLTVSRLGFGTYRVGQREAEHREALIKALRSGCNLIDTSTNYMDGESEQVVGS
    VLQQLIRAGEVAREEIIVVSKIGYVQGQNLAQAKTREKSGKPYPDMVKYGDDIWHCIHPEFLADQLTLSLDRLGLATLDV
    CLLHNPEYFLSHATRLGAGEQRDLSRLRDELYVRMQLAFEYCERQVESGRLRGYGVSSNTSTASPDESGATSLSRMIEAA
    KAAARKVGASAHHFTVLQCPMNLHESGAALIKNTGPDNGSTLLAEAVKEGVAVLVNRPLNAMPAQRGGVVRLADVPVPAP
    APAPEAEFETQRQKVALLEEAYRKDLAPAVAHSGQGMLPADFFRWADELNRIRTQVQGLEHWEQIETQMIAPHVNQVLRA
    LSEALTGPIAEQWEAWRDRYVPELLALLRTLHREASERSRLRAEDLHRTIDPLLPEQRRKATLSQKALWILASTGGVTSV
    LNGMRTPAYVDDALQILRWEPLSDSRRVYECCAEKK

    >gi|302037760|ref|YP_003798082.1| putative arsenate reductase [Candidatus Nitrospira defluvii]
    MAEITIYQKPTCSTCREAVRIVRESGQPFKAINYYEQPFTKSRLKALLKKAGLTAREVLRTKEDLYKSLKLADPALTEDH
    VLDLMVLHPDLIQRPLVEKGDKAMLARPADTITHML

    >gi|302037837|ref|YP_003798159.1| soluble pyridine nucleotide transhydrogenase [Candidatus Nitrospira defluvii]
    MPPNAYDIVVVGSGPAGQKAAIQGAKAGKKVVLIEQEQGIGGNCVYRGTIPSKTLRETALQFERLKRSSEVFEGRLRLDV
    PMSVLLHRLDEVVKAHECYMADQLTRNSVTYRHGRARFLSPNEVELETIDGACQALRADTIVLATGSRPRSIPEIPVDHE
    HVLDSDSILSMIYLPRSLTVLGGGVIACEYASTFALLGVEVTLIDRAQRPLSFMDAEIVEVFQRSIERQGGRFYVGQTVK
    EVAWDGVSSVVARLANGMAVKSEKMLVALGRQPNVEELNLEAAGLTLDEKGRIPVNEYGQTPVPHIFAAGDMLGRPPALA
    SQAMEDGRRAVSHALGLPVGDSLNQVPIGIYTIPEIASIGLDEEQAAARYRGPLVGRARFTEIAKGQITGACDGLLKLIA
    DPSGERLLGVQIVGEHATELIHLGQMALQDGATIDRFIDSIFSFPTFAEGYRVAALDILGQRRKRQSSAQAA

    >gi|302038036|ref|YP_003798358.1| dihydrolipoyl dehydrogenase, E3 component of Pyruvate and 2-oxoglutarate dehydrogenase complexes [Candidatus Nitrospira defluvii]
    MNHLAILGAGPGGYVAAIRAAQLGARVTVIENQALGGVCLNWGCIPSKALLSVVEFGDKAKKAKDFGIQLSGPATYDPAV
    MVARKNKVVSTLVKGIATLFKTWNIEHLEGTGELLDARTIRVTKPDGAEIRVEADGLILATGSSWPNLPLFPIDGTQIIT
    SKQALELSRIPASLLIVGGGVEGCEFASLYSGLGTQVTLVELVPRLLPLEDEEISQMMERELKKRGVDIRTGVTVDQIVR
    QPEVVTAHLRDGLSLNVEQVLVSVGRGFNSRGIGLEKAGVQVGPRGEIVVNDRMETNVPGVYAIGDVVGKAMLAHVASAQ
    GKVAVENFMGHPRTIDYDVIPTGIFTLPEIGRVGLTEQQARDRCLAVGKDPQQSVRVGRFRYGGLGKAQATGDIQGLLKV
    IVDAGSDRILGVHILGAHATDLIHEAALAMHLGGTVSRVAEMIHAHPTLAEGLMEAMEDVHGHAIHLARKPSS

    >gi|302038101|ref|YP_003798423.1| hypothetical protein NIDE2793 [Candidatus Nitrospira defluvii]
    MTNATTTGMDQTTGLYDLANLAKMKDLGTHAPEAMKAFVAFDKAALAAGAIPVKYKELMAMAVAFTTQCPYCIELHTSKA
    REYGASEAEIAESVLVAAALRAGGAITHGTHALKGI

    >gi|302038122|ref|YP_003798444.1| thiosulfate sulfurtransferase GlpE [Candidatus Nitrospira defluvii]
    MLTASLFVAIALSVPSPAVAQTFPPSVTQKIRAAQKEVKTIGLEEYRKVVESPGEALIIDVREPQEFAAGHVPGAVNIPR
    GLVEFQIWKQVGFPAEPDTNRPVYLQ
    CQNGNRASLAAQSLAELGFTNTTAVVMHFEEWQQAGHPLVK

    >gi|302038516|ref|YP_003798838.1| putative 3-mercaptopyruvate sulfurtransferase [Candidatus Nitrospira defluvii]
    MQHPLLIDCETLQKRLGQPGLVILDVRGRAAYEFGGHIPGAVHSTWHEYSDPDAVAKGLLDPDLKRIEKRVQALGINQDS
    EVVIYSNPFDNWGDEGRMFWMLEYLGHKNLKVLDGGWVKWIHERRPFEHGAVRCAPGNFVVAPVESAIIMKNELKGIARK
    PNPTTTIVDARSLEEYLGKEISGIPRPGHIPGAVHVAWSGFLNADATVKDLAAINAQLDLKGLNPAHETICY
    CTGGVRSA
    WLYFILRLAGYQRLRNYPGSWWEWSRDFACPVEKDLLALQKLLGLSESQVPTGMRPS

    >gi|302038784|ref|YP_003799106.1| hypothetical protein NIDE3496 [Candidatus Nitrospira defluvii]
    MESLTNMLAQHGALVLFAVVFAEQVGLPFPALPLLVAGGVLVGTGHLAWSSALGAAILATLMADAIWYLAGQWRGRPVLG
    LLCRIALEPDACVRRTEDFFLRHGPKSLIVAKFIPGLSTIAPPLAGIVGLSVPLFLLYDTLGALFWAGSGMGFGYAFSGQ
    IEQAFAYSEQVVPALLLMMVCLLAGFVSLKAWQRHRQLRLVPRITVAELAEKLAAAEPPMLIDVRPRARAEAEPGIPTAV
    LMSLDELARRYREFPRHRDVVVY
    CGCPADVASAQGALLLQKQGFTRVWPLAGGIEAWRAITTQSSERAQGFVGPQVAA

    >gi|302038806|ref|YP_003799128.1| putative oxidoreductase [Candidatus Nitrospira defluvii]
    MNPGSDRLLLSLGFALAACTFLSPVEVRAAGPSGEPLTRQALEQMIEQYIRTHPEVIEQSLQSLENKRAAEEQERQKAAL
    ATHQQELLNDPASPVSGNPAGDVTVVEFFDYR
    CGYCKRAASALTQLQQSDARVRVVYKDFPILGETSELAAKAALASNLQ
    GKHRAFHEALLATKDDLTKEQLFRIAAEAGVDVNRLDQDMTRPEWQPILDRNRALAKTLGISGTPAFIVGNDLVPGALDL
    KTLQELVAHKRKQ

    >gi|302038825|ref|YP_003799147.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Candidatus Nitrospira defluvii]
    MTSSASTTGRINRTIRQDPRWAAILARDPAADGTFYYSVRTTGVYCRPSCAARQPLRENVRFHATCADAEQAGFRPCKRC
    RPDQPSSVDRQARIVVAICRYIEQAEHLPSLDELAQRAKMSPSHFHRVFTSATGLTPRGYAVAHRATRVRCELGRDRPVT
    EALYRAGFNSSGRFYEASNALLGMTPSRYRAGGAQSKIRFAVGPCSLGAILVAQSERGVCAILLGDDPDALTRDLQARFP
    RANLTGGDAAFERLVSTVVGFVETPGRGVKLPLDIRGTAFQQLVWKALQRIPVGSTATYTEIATRIGSPKSARAVGRACG
    ANPLAVAIP
    CHRVVRHDGGLSGYRWGVERKRMLLERESSVAP

    >gi|302038845|ref|YP_003799167.1| iron-sulfur cluster insertion protein ErpA [Candidatus Nitrospira defluvii]
    MVTITQLAEQKIKELMTEEKDVVGLRIYVRGGGCHGYQYGMAFESKMADDDTVIEKGDVKVIMDSQSAPLLQGAEVDYVD
    SLQGSGFSIKNPQAKTTCGCGSSFSA

    >gi|302038860|ref|YP_003799182.1| putative glutaredoxin [Candidatus Nitrospira defluvii]
    MALTLYHVQWCPDCAVVRDRLDELNLSYEDVVVPDFRPMRTQVFEVSGQYYVPVLKDGDTVLTETHDILAHLDTQYDKAR
    P

    >gi|302038868|ref|YP_003799190.1| glutaredoxin [Candidatus Nitrospira defluvii]
    MADPIEDEIQQEIKANKILIYGKGTKAMPMCGFTRETMHFFEKYGYPYELIDVLSQPAKREALTKLTNWPTLPKVFIDGQ
    FYGDTDILDPMEAKGEVMPLLKKAFGAE

    >gi|302038980|ref|YP_003799302.1| putative methyltransferase, UbiE-family [Candidatus Nitrospira defluvii]
    MAIDDITQKVSDRYARAAATGEQMCCPTGYDFADLKSFVPEEVLTISYGCGTPAGLNTVRPGETVLDIGSGGGIDCFEAA
    RRVGPTGRVIGIDMTDTMLEIARRNAPIVAGNLGYATSNIEFRKGMADAMPVEDASVDLIISNCVINLAPDKRKVFREMY
    RVIKPGGRFTISDIVSDQVVPQYLVHDAAKWGD
    CLSGALQVQDYIGGMVDAGFRAVHQIKSTPWQSIDGIHFLSVTLTGY
    KLPAIADEQVSSYATLRGPFSSVTDELGQRYERGVPHRIDGPSAQLLQSEPLRSLFLLGPAPVTLTDSDPRWCAIHPEQK
    PCVWQGTYAILTGPIISAEDDDHHQYYRGVPLEICSKTLQVLTQEAYRPHFTIYQRASAGVDGEAVSCSPEGNCC

    >gi|302038990|ref|YP_003799312.1| putative arsenite S-adenosylmethyltransferase [Candidatus Nitrospira defluvii]
    MDAQAIRDLVKETYGEAAARAKSGGSSCCGASPALMNVDPITSNLYSDQERQELPADAVAASLGCGNPTALAELHAGETV
    LDLGSGGGIDVLLSAKRVGPTGKAYGVDMTEEMLALARENQRAAGVENVEFLKGEIEHLPLPDRSVDVIISNCVVNLSGE
    KERVLAEAFRVLRPGGRLALSDIVVRGAVPSEIRRNLELWAG
    CVAGALEETEYRDMLAQAGFVEIGIEPTRIYHADDVKE
    LLVGADLSSDLLVAQVEGKFMSAFIRAKKPAVTV

    >gi|302038998|ref|YP_003799320.1| putative thiosulfate sulfurtransferase GlpE [Candidatus Nitrospira defluvii]
    MSFTITPKDLKSRLDKGDKLVLVDVREPWEYAIAKLEGSILVPLATLQQSLGKLDRDAEIVAVCHHGMRSADATGFLLQQ
    GFGKVKNLIGGIDAWSTQVDPSVPRY

    >gi|302039153|ref|YP_003799475.1| thioredoxin [Candidatus Nitrospira defluvii]
    MTETLHLVCPHCRSINRVPAARLAGQPNCGQCHAPLFTGHPIALTAADFDLHAQRAEIPLVVDFWASWCGPCRMMAPAYE
    QAAQMLEPQVRLAKVNTEEEQALAARFGISSIPTLVLLRGGRELARQPGALGLQDIVRWVRSKI

    >gi|302039156|ref|YP_003799478.1| hypothetical protein NIDE3881 [Candidatus Nitrospira defluvii]
    MATFIISGSRGTDDPTMATLPFMAAKTAKEQGHDVVLWLWNEAVTSARKGSADHVVGVNLTPLKDLLAAVQAANIPIWVC
    GACAVARQIGQGDLVAGAVIKGMPDYIKAVAERDRTVAF

    >gi|302039160|ref|YP_003799482.1| hypothetical protein NIDE3885 [Candidatus Nitrospira defluvii]
    MKLSVAYQGGARYDILSDRHRIVTDQPVEDGGADAGMSPVELFVGSVASCVGYFVGQFCARHDISREGLKVDAEWTIAEA
    PHRVGQIQLAIRLPHRVTPELRERLLKVAHGCTVHQSIVVPAGIAIELNPHGHPAAGSDLTEEK

    >gi|302039170|ref|YP_003799492.1| putative peroxiredoxin OsmC [Candidatus Nitrospira defluvii]
    MEVRSKVYTYRTAVRWTEQKKGTITCEGKPDIQVATPPEFKGHEGIWSPEDLYVAAANICLMTTFLAVAERAGLAFTSYH
    CEAEGRLELVEGKFQVTVITLRPQIALQSGSDAAKAKELIEKAEAN
    CLISNSMKTRITLEPTIT

    >gi|302039249|ref|YP_003799571.1| hypothetical protein NIDE3976 [Candidatus Nitrospira defluvii]
    MTPVTAWLLRVGASCFLLLLVAGAALAASAPAVDHRMRGKADAPVTLIEYSDFTCGYCLKFFKETWPKIQARYVDTGKVR
    FLYKDYPRADQGPGVTAALAARCAGDQGTYWPMHDRLFAADGRLDVDSYSQHAKAIGLDQSQFRQCLRDAPHMQAIFHDR
    DEANSWGFHGTPGFVLMRTAQQPTTKNPAIAIPGAFPFEAFEEEIEKLLAPAGAKQK

    >gi|302039298|ref|YP_003799620.1| iron-sulfur cluster assembly protein IscA [Candidatus Nitrospira defluvii]
    MDATTNTDAQAPVITLSDAALKEVKRLINVQGIEEGGLRLGVKGGGCSGLSYTINFDEKIGQYDQVYEFDGVKVIVDAKS
    AIYLQGTQLDFQKDLMGGNFKFVNPNANKTCGCGESFSA

    >gi|302039305|ref|YP_003799627.1| peroxiredoxin [Candidatus Nitrospira defluvii]
    MSDVAAEIKVGDTAPDFTLKDQDQKDVKLSDFRGKSNVVLAFYPLDWSPVCQGENKCLTDDFPKFQSAHAELFGISCDSF
    FSHKAWADSLDLKHRLLSDFNREVVKKYGLYFEPLNCGKRATVIVDKNGKVAYVKVQEIKVAREDKDILAALAKLS

    >gi|302039306|ref|YP_003799628.1| putative thioredoxin [Candidatus Nitrospira defluvii]
    MTGTVQDVRDENYKEFTESAGAVVAYGLATCEPCKQYDPILEETAAKFPTIKIGKAKMHVPGRCREIKKAHTFETYPTTH
    FFAQGKLLLTREGVVEPAELAALISDHLLK

    >gi|302039591|ref|YP_003799913.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Candidatus Nitrospira defluvii]
    MMHAITFQTAWGLIRITASEKGVTAIDLSPSDPGARQQPAAEAGGAAASIMAEARAQLLAYIAGTRREFSFPVDCSAGTP
    FQRKVWKAITRIPYGRVRSYQWVAIRVGGKQYARAVGMALGANPVPIVVP
    CHRIVSHDGSLGGFSCGLPLKRRLLNLEGT
    LSQLRNAQ

    >gi|302039604|ref|YP_003799926.1| putative dihydrolipoyl dehydrogenase, E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes [Candidatus Nitrospira defluvii]
    MIGGGSAGYAAARTARDAGADVAIVDQGPLGGLCILRGCMPTKTILRSAEIMALMKRAREFGLNPVTAQADLSAIVDRKN
    RLVQEFADYRIAALRDPRFTLYESRAEFLSPHELRAGDGRIRGGAFVIATGSSAAEVAIPGLDEAGYLTSDEMLDVRRQP
    ASLLVLGGGLVAVEFAQFFARIGTKVTMLQRGTTLLSDMDGDIGHALAAAFRDEGIEVMTGVSFQRVSSGSSEKIVHFIQ
    GGAVHTRSAEVIFQALGRRPNLNGLNLKAAGVCVVDGRLVVGGDMRTSQPHIFAVGDVNDLTPIVHLAIEQGETAGFNAT
    HPNEPARVIDHRLDAEVVFTEPQVAVAGMSERQCREKAIPYLTASYPFADHGKAMCLGAVHGFVKLLCRPDDGALLGAQI
    VGPEAGELIHELIAVMYFHGTAQDLLRIPHYHPTLAEIVTYPAESIVEQMGRA

    >gi|302039623|ref|YP_003799945.1| peptide methionine sulfoxide reductase MsrA [Candidatus Nitrospira defluvii]
    MNIVTGRGIYTWLVLAMVLAGSLASAGQAAGPAGTAKAYFAGGCFWCMEEVFEKVPGVTSVTSGYMGGRVEHPTYEQVSA
    GGTGHAESVEVVYDPAKVSYTALLDAFWRNVDPVTPNAQFCDHGSQYRAVIFYLGDEEKRLAEESKGAIEQSARLPGRIV
    TELTLASTFYPAEDYHQDFYKKNPVRYKFYKYNCGRAQRLEDLWGAP

    >gi|302039647|ref|YP_003799969.1| hypothetical protein NIDE4384 [Candidatus Nitrospira defluvii]
    MTAHSLETLTFDNSYARLPEAFYAKVNPTPFSAAPFLISANRAAMELLDLDPTEAARPEFAGVFGGSLLIPGMEPLAMLY
    SGHQFGVYVPQLGDGRAILLAEVKNGRGERWDLHLKGAGMTPFSRDGDGRSVLRSAIREYLCCEAMHGLGIPTTRALCLV
    GSDDKVYREQVETGATIVRMAPSHVRFGTFEIFYYRKQHEHLQRLADYVIEMHFPDLAPAADKYARFFAGVVERTAKLIA
    HWQAVGWSHGVLNTDNMSILGLTLDYGPYGFMDDYDPGFICNHSDYNGRYAFNQQPYIGLWNLSCLAQTLLPFAPKEELK
    AALDGYQTSVDRHYHNNMRAKLGLVEDRAEDEALLQELKSLMVGSRVDYTIFWRELGTFSSDAGAKNERLREHFLNPERF
    DAWAGQYRDRLQGEQSRDEERRIRMDRVNPKYILRNYLAQGAIEKAQQKDYSEIERLLTLLQQPYTEQPGMDSYAAAPPN
    WGKHLSVS
    CSS

    >gi|302039660|ref|YP_003799982.1| hypothetical protein NIDE4398 [Candidatus Nitrospira defluvii]
    MSAKKFGILLSTPPSHPSVETVAQLASEALTEGIDLYLYFIDEGVKNLRDHRYVELVGRGMKLFVCAYGCQQHGVSTDAL
    DSRISLCGLVVLSNIVNGCDRFLAFT