Candidatus Koribacter versatilis Ellin345 uid58479

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94967189|ref|YP_589237.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
    MSLFKSLAVVVLAVCVGCSAQSSSNTQSQNKLSDAQLNRRIQDQIRAHFSVPPQVNITVGAPKPSDFSGYDAVTVAISDG
    DKSKNYEFLLSKDGKTLARLSKIDLSKDPYEENMAKIDIANRPVRGNKDAKVTIVNYDDFE
    CPFCARMHSELVNVLKQYG
    DKVRIIYKDYPLTEIHPWADRAAVDSNCIASQNTDAYWDFADYVHSNQPAITGKKEEHRSVAAMQEAVDKVTLDIGRKHS
    LNVDQLQACIKNQSESAALKKSVSEANGLDVSATPTMFVNGEKLEGAIEEDALIDVIKKHLQEQGSTGTGASK

    >gi|94967212|ref|YP_589260.1| alkyl hydroperoxide reductase [Candidatus Koribacter versatilis Ellin345]
    MKNNIAILGFAVLVIAAMLFVGSNIARKKQAEAARSGSLVVGQVVGKPAPDFTLQTLDGKKVTLSDLRGKAVVLNFWATW
    CPPCKVELPWFVDFQKQYGPQGLQIVGISEDEGGKEKVAAFVKEMGVNYTIAVDDDTVSRKYGDVEDLPTTFYIDRNGKI
    VQFAMGLADRSEIEEKIKSALAQ

    >gi|94967234|ref|YP_589282.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Koribacter versatilis Ellin345]
    MTLSQPELLRYSRHLSLPEFGLEAQERLKQTKVLCIGTGGLGSPLAMYLAAAGVGTLGLVDFDIVDYTNLQRQIIHTTPD
    VGRPKVESAAEKIDVLNPFVNVVPINAKLTSANALELFSQYDIIADGTDNFATRYLVNDACVLTGRPNVYASVFRFEGQA
    SVFATKSGPCYRCLYPEPPPPGTVPS
    CAEGGVLGVLPGLLGIIQATEVIKVACGIGQPLIGRMLLVDASTMKFQELRLKR
    DYQCPACGTRTLKELIDYDQFCGIRGQESSVAGDITVEELKRRLDAGEKPFILDVREPHEYQIANLGGHLIPLNDLPKRI
    GELDPTQEIITH
    CKMGGRSQQAVDFLRQQGFKNAKNLTGGINAWSEKVDPKIPKY

    >gi|94967304|ref|YP_589352.1| methylated-DNA--protein-cysteine methyltransferase [Candidatus Koribacter versatilis Ellin345]
    METLYYSQMKSPIGQLWIAVSKNGLVMIEFEGREFPPVKFDKNVSWVISEEKTAKVKKQLQQYFDGHRTEFDLPLDPRIG
    TDFQRKCWDLVAKIPYGETRSYQELAKELKSPNASRAVGGANGANPIPIVVP
    CHRVINSDGHLGGYGGGLDKKEQLLSLE
    RALPGTGPLFFKAPKSKSAKVGV

    >gi|94967334|ref|YP_589382.1| OsmC-like protein [Candidatus Koribacter versatilis Ellin345]
    MQRTASAHWEGGLKDGKGSVSTASGVLKQTQYSFATRFENGAGTNPEELIAAAHAGCFSMAFSAELGKAGFTPTSIDTSA
    TLTLDKTDAGFTITAIHLDVHAKIPNIDQAKFEEIANGAKKG
    CPVSRVLNATITMTAHLS

    >gi|94967442|ref|YP_589490.1| alkylhydroperoxidase AhpD [Candidatus Koribacter versatilis Ellin345]
    MNPERKEPEYLFTEKQVGEKSGIAQRFLDTRAELNGIVTQADNYLVKRFYNIDHNTYLEGAIPAKYKELMGLVVSAGLRC
    DD
    CINYHIIQSYRLGANRPEQEEALNVALVVGGSIVVPHLRRAYALLQELYS

    >gi|94967513|ref|YP_589561.1| HesB/YadR/YfhF [Candidatus Koribacter versatilis Ellin345]
    MTTIETQQAQSAPPKGIQITEKALEKVRVAMVKENVSPTEGGLRLGVQGGGCSGLSYNVRFDTQPRERDRIFQYGDIRVF
    VDPKSFIYLNGMTLDYEETLMNQRFVFVNPNASKSCGCGSSFA

    >gi|94967830|ref|YP_589878.1| vitamin K epoxide reductase [Candidatus Koribacter versatilis Ellin345]
    MRKTLALVLSLIGLFDSAYLWWVYTSPTHPLVCLGSGCDDVRASRFAFWGGIPTPAFGAVLYATLVILIVAESFAGESTS
    KLLKRIAFYLSAAGLIVSLYLTSLEAFQIHAWCAWCVAQQIAIALIFILLGVELGKPESDTPKRAQRNVAVLIICVVLAI
    PAFAWLSNHSAAEVKKQLDANSTEGPADLTRLIRPDSHTAGPADAPITIVEFGDFQ
    CPSCIIAEATNRQIRRNYPKQVRF
    VFRQFPLAKFHVFAERAAEAAECADDQGKFWQMHDRMYEADGELAPVQLKYYAQDIGLDSAKFNACLESGEKEARVKADM
    EDGKAVGVGATPTFWVNQVKHVGGLKLQDIAVAAAAPAQSSEAAPSAPPGPAKPVPAALAATVTFDKNSSKAKKEAAPVE
    NKPATNSTAPPTATASLIPGAAPAANPLAVGQSDSGDCDVNAPKGPGKNEIPTNAAQDLHKKGALFVDIRSPKDFAKSHI
    SGAVNLPLNKLSDGAGTLPKDKPVVVYESGLAAGDV
    CAASRAAAGLLASRGFKEVKVYHDGFAGWQKAGGSVQ

    >gi|94967836|ref|YP_589884.1| peroxiredoxin-like [Candidatus Koribacter versatilis Ellin345]
    MFKFFRAMFKTPRRSRMATLEAGVKAPDFTLPTMTGETFSLSKALEKGPVLLAFFKISCPVCQFAMPYIERMYQASKGKP
    VTVIAVSQDDQRATLAFLKEYRITMPVALDDTKSYPASNAYGLTTVPTFFLINPEGDIGIASGGWFREEQEQFYRALAGG
    GEYFQANERIPDLKYG

    >gi|94967871|ref|YP_589919.1| mercuric reductase [Candidatus Koribacter versatilis Ellin345]
    MSRHFDAIIIGTGQAGPSLAARFSDAGMSVAIIERNKFGGTCVNTGCIPTKTLVASAYAAHVACRGADYGFTTGGAVQVD
    MKRIKARKDAVSGKSNKGVEEWLRGLKNCTVIQGHARFRSARTVSVNDELLDADRIFINVGGRASVPELPGIHDVPFLNN
    SSMMDVDFLPKHLVVVGGSYVGLEFGQIYRRFGSEVTVIEMGPRLVGREDEDVSQSVREILEAEGIKIRTDAKCISLSKH
    EGGIAVGVDCEDGEPEVIGTHVLLAVGRTPNTQDLGLDQAGVATDARGYITVDDHLQTSVPGIWALGDCNGRGAFTHTSY
    NDYEIVADNLLNGDHRRVSDRIQTYALYTDPPLGRCGMTENEVRKSGRKALVAKYPMSRVSRAVEKGETQGLIKLLVDAE
    TKQFLGAAILGTGGDEVVHVLLDMMYAKAPYTVVQRAMHIHPTVSEYLPTILGKLEPLK

    >gi|94968311|ref|YP_590359.1| transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Candidatus Koribacter versatilis Ellin345]
    MSTETMWEKVLQRDAAADGRFVYAVRSTHIYCRPTCPSKRPNREQVEFFANPKEAEQKGYRACRRCAPKTENIASHVARI
    CRELTDDYKGLSPEDIAAREGLALRRLNQIFRTVLGVTVREYLASHKLEDFKSKLKTSQDVTGSMYDAGFGSPSRLYEKS
    DAVLGMTPASYGRGGRGAHIAFGIRDSEIGHILIAATEKGVCTISFGDNAKKLESDLRKEFHAAEITRNDDAVEQYLDAI
    AAHIEGNEFLTSIPIDIHATAFQAKVWQLLRNTKPGETLTYSGLAAKLGAPSASRAVARACASNRVAIAIP
    CHRVVAASG
    DLSGYRWGVERKRQLLQRERKQVV

    >gi|94968365|ref|YP_590413.1| thioredoxin reductase [Candidatus Koribacter versatilis Ellin345]
    MTDNVRNTVILGSGCSGLTAAIYAARANLKPLLIQGHEPGGQLSMTTLVENFPGWPEGIQGPELIENMHKQAERFGTEFH
    TGHLHSADLSKRPFELHMGKETILTKTLIIASGASARWLNLKSEQELIGHGVSS
    CATCDGFFFSGKEISVIGGGDSAMEE
    ALFLTRFATKVHLIHRRDAFRASKIMLDRARKHEKISMITDTVVEEVHDPAQKEVTGLTLRNLKTDKVWDLPVSAMFLGI
    GHHPNATAFGDQLDKDADGYLITKDYVFTKVPGVFASGDVQDRRYRQAITAAGSGCMAAIEAERFLEEHGG

    >gi|94968609|ref|YP_590657.1| HesB/YadR/YfhF [Candidatus Koribacter versatilis Ellin345]
    MPSPELATLIYFRVPTRRWDRFGPKISATLPQLVHLNIEFLRISGRFGPVWYNQADHPRRMATMATTATPNTTTPTKSAP
    LNLTPNAVAKVKEIMSQQNPVPAGLRVGVVGGG
    CSGFSYSMNFETSAGLMDKVYEFDGLKVYIDATSVVYLNGAVVDYVE
    TLEGAGFKFENPNVKSTCGCGSSFSV

    >gi|94968870|ref|YP_590918.1| thioredoxin-like [Candidatus Koribacter versatilis Ellin345]
    MKRASSFMAIAIWILSAAAIAADSQPKPAPDFNLTDSEGKPVHLAELKGKVVLLNFWATWCHGCKTEMPWFVELQKKYGP
    KGLVIVGAAMDDDGWKSVKPYLSEHPLNYPVVLGDATLSEHYHVGPMPQSVLIARNGTISASYAGVVDLPVCEQKIERLL
    KSGS

    >gi|94968899|ref|YP_590947.1| glutathione peroxidase [Candidatus Koribacter versatilis Ellin345]
    MGLYDLSATLNNGKEKKLSDYKGEVLLVVNTASECGFTPQYKGLQELYEKYKNQGFEILGFPCDQFGHQEPGSDKEIASF
    CEVNYGVTFPIFSKIEVNGANEHPVYKFLKSEKGGLLTNNIKWNFTKFLVDKQGNVVDRYAPQTIPARIAADVEKLLST

    >gi|94969040|ref|YP_591088.1| methionine sulfoxide reductase A [Candidatus Koribacter versatilis Ellin345]
    MEKATFAAGCFWGVEETFRTTPGVVATAVGYTGGHTENPTYHDVCTDTTGHAEAVEVTYDPAKVSYDDLLKIFWENHNPT
    QMNRQGPDVGAQYRSAIFFYSPEQEAKARASKEALEKSGRFSKPIVTQVVPAEPFYRAEEYHQQYLLKRGRTHCHI

    >gi|94969239|ref|YP_591287.1| thioredoxin-like [Candidatus Koribacter versatilis Ellin345]
    MDAPQFTVSDADRTVSLKDFRGKTVVLNFWATWCPPCVEEMPALVDLQKQLGDKVVIVAVSMDVDEHAYKQFIRDHHVDL
    LTVRDAANKSNTLYGTYKFPETYVIDKDGKIRRKFIGGADWTSPDIVNYLKSL

    >gi|94969257|ref|YP_591305.1| glutaredoxin [Candidatus Koribacter versatilis Ellin345]
    MLQPRITLFTRPDCPPCGWLKDWLRERNLEFEEYDVSVDKIAVFTLVRKYRSQSTPTLVIGEGEEDVLIGFEPEKIEAAI
    DRHRPDR

    >gi|94969309|ref|YP_591357.1| rhodanese/sulfurtransferase-like protein [Candidatus Koribacter versatilis Ellin345]
    MSKSLEYEIQPEEVKPLLGTEGVVLVDVREPWERDTAKIEDTLFIPMGDIPARIQELDPDDHVIVVCHHGVRSLSVAAWL
    RQQGYEKAQSMAGGIDRWSRFIDPKVPLY

    >gi|94969411|ref|YP_591459.1| hypothetical protein Acid345_2384 [Candidatus Koribacter versatilis Ellin345]
    MSSRSNALGNASSSYLRSALHQPIHWHQWGPEAFAAAQQENKPILLDIGAVWCHWCHVMDRESYDDPEVADILNREFIAI
    KVDRDERPDVDSRYQTAVAAITGQGGWPLTAFLTTEGKPFYGGTYFPPRDAHGRPGFKKILLAIADAYKNRRDDVLREAD
    GMMTALHHAEGLAGHGGDFNPRVITMMVQSALNSFDPKNGGFGSAPKFPHASIVEVLLDWYARTGEDGAANVARTTLEKM
    AQGGVYDQIAGGFHRYSVDENWIVPHFEKMSYDNSELLRNYVHAAQLFPDAAFAETAKDIIRWVDSTLTDREHGGFYASQ
    DADINLEDDGDYFTWTVDEAKAALTAQEFEVAALHYDINEVGEMHHNSAKNVLWIRAEVEEIAMRLSLKPDQIRMLLNSA
    KQKMLVARLQRPTPYIDKTVYVNWNAMFVSAYLAAGRVLGMKDAHHFALRTLDRILGQWNDKQQLPHVIAYSDPNAVLRE
    SRGLLDDYVFTALACLDAYEATGDLTYFRCAQQIADTAIAKFGDATSGGFFDAEPTTEQVALGALSVRRKAFQDSPTPAG
    NPAAAILMLRLHAYTNDTRYRDKAEDTLETFAGAVEQFGIYAGTYGRAAIWFSKPHTQVVIIGTDASAADLERAAFQTFA
    ENLSVIRLAQADAHLLPPALAETIPNVPGVNDGRAVAVVCSNFACQPPITSAQDLTDTLKKLLRS

    >gi|94969504|ref|YP_591552.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Koribacter versatilis Ellin345]
    MQFQERYSRQILFHGIGAEGQQRLAAGRAVIVGCGATGSALASLLARAGVGYLRIVDRDYVEPSNLQRQGLFDENDAAEA
    LPKAIAAARKIHAFNSEITVEPHVDDLTPDNADDLLANVQLILDGTDNFETRYLINDYAVKNAVPWIYSAAVGSYGVAMN
    ILPGETACLACVFPDSPRGVVET
    CDTSGILNTAVNEVASLSATEALKYFVGAREKMRRTLVSTDVWTNERSEIRTGGPKP
    GCRCCGKRDFSHLSGEGRPHISLCGRNSVQIHERQRPIDFAMMETRLRPHGQVRHNEFALRFFHEPFEMTLFPDGRAIIK
    GTTDIGVARSLYARFVGS

    >gi|94969550|ref|YP_591598.1| DSBA oxidoreductase [Candidatus Koribacter versatilis Ellin345]
    MIKKISLLLATLVFAAAAFAQSNVPEATVRSFIGQMIGYDNGVTVKSVSTKPAEAPGFTEVTVLLNTAQGDQVLNFFVSP
    DGKFALIGQLMDFGADPFVRYRAALQKADGPSKGPKNAPVTIVEFADLE
    CPACKAALPSIEKMQTENANVRVIFQNFPLE
    KLHPWAARAALYVDCLKTDDVVAWKFIDGVYEHQQDINEQNADDSLKKYAGEAGADAAKTAGCIADPKTRANVQASEKLG
    EGLAITSTPTLFINGRKVSSFNSLPAETFKQLVDFAAKNAK

    >gi|94969811|ref|YP_591859.1| glutaredoxin [Candidatus Koribacter versatilis Ellin345]
    MNLTLYSAQWCPDCRVAKRFLDKHKIPYREVNIETTPGAAEELIRNVGKRAIPQFVIDGKWVQPYRPGHGFLYDEMAELL
    GVSS

    >gi|94969813|ref|YP_591861.1| protein-methionine-S-oxide reductase [Candidatus Koribacter versatilis Ellin345]
    MADKVNKTSEQWREQLTPEQYHVARERGTERAFTGKYWNTHTDGTYKCICCGEPLFSSEAKFDSGCGWPSFFVPLDQQNV
    TELEDRGFGMTRTEVRCSKCDAHLGHVFEDGPKPTGLRY
    CINSASIDLDPKEKK

    >gi|94969817|ref|YP_591865.1| dihydrolipoamide dehydrogenase [Candidatus Koribacter versatilis Ellin345]
    MADQKTPNIAVIGGGPGGYAAAFLAADLGMTVTLIDMELNPGGVCLYRGCIPSKALLHVAKLIEEAKHSTNWGVTYDAPK
    IDLERLRTFKEGVVKKLTGGLGQLSKQRKVTYIQGKATLVDSCTVKVEKTAGGEETLHFDKLILATGSRPAVIPAFNIGS
    PRVMDSTGALNLEDIPKRLLVVGGGYIGLELGSVYAAIGSKVSVVEMTAGLLPGADRDLVAPLHKRLTGIFEAIMLNTTV
    ISIADTGSAVKVKFKTQDGKEEEQTYDRVLVSVGRKPNSQIPGLDKTRVKVNQKGFLQVNPSLMTDDPFIYAIGDVVGEP
    MLAHKASHEGLVAVESIAGHKVAFEPQAIPAVVFTDPEIAWAGLTETQAQNEGREVTVTKFPWAASGRAVTIDRTEGLTK
    LIIDPQTERVLGVGICGPGAGEMIAEGVVAIEMGALAGDIKLSIHPHPTLSETIMEAAEVFYGQSTHIYRPKRK

    >gi|94969842|ref|YP_591890.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Koribacter versatilis Ellin345]
    MKFRKALLIGALALVPLALSAKVEVGQPAPDFTLTSQDGNQVSLSQFKGHWVVLYFYPKDFTSGCTVEAHKFQDDQDKYK
    ALDAAIVGVSVDTADSHKQFCTKEGLTFKLLADPTAKVPAEYDSIMEYQGTKLAARHTFLIDPSGKVVKSYMEVNPKNHS
    EQVLADLASLQKK

    >gi|94969986|ref|YP_592034.1| methyltransferase type 11 [Candidatus Koribacter versatilis Ellin345]
    MKNEITTAVEEHYAAVARGEASACGAPVENVAKAIGYTEEELALAGDANLGLGCGNPLALTELKPGMTVLDLGSGAGFDA
    FLALSRVGTTGRVIGVDMTDDMLALARQNAEKRGSDNVEFRKGFIEALPVESGTVDYVISNCVINLSSDKPAVFREIARV
    LKPGGHFAVSDIVLLKPLPDALAKDISAYVG
    CISGASLINDYLSMALTAGLADLSIPRIATGKSLMEVLSPADVCSGGSS
    CCGSTVQISVKNPDEMVRQASEALASIKLHGRK

    >gi|94970074|ref|YP_592122.1| electron transport protein SCO1/SenC [Candidatus Koribacter versatilis Ellin345]
    MRLTRQVAPLVALLVLFTSCSRKPERRYDLSGKIIAMDAKAHELTIQHQDIPGLMKGMTMPFRVKDDWVFQAAHPGDSIT
    ATLVISGDSSHLENPVITQSSGPTTIDGSVRVPQIGDTVPDFAFTNQDGKKIKLVQFRGKTLLLTFIYTR
    CPLPDYCIRM
    SNNFSAVARQMKQQPSIYDKTQQLSISFDPEYDKPAVLREYGGRYAGDVDPKFTHWQFVTATPEETKKVADFFGLSYTPD
    GATIVHSLRTAVIGPDGKIAHIFSGNDWKPEDAVSAMESTLQ

    >gi|94970094|ref|YP_592142.1| thioredoxin [Candidatus Koribacter versatilis Ellin345]
    MATDTIVEVTDSNFDQLVLKSDKPVLIDFWAAWCGPCKALAPIVDEVAQSYNGKVTVGKMDVDKNAATPSRYGIRGIPTL
    LLFKGGQVQEQIVGYVARERIEQAINKAL

    >gi|94970108|ref|YP_592156.1| OsmC-like protein [Candidatus Koribacter versatilis Ellin345]
    MEVTVNHLGSVQFEIKARQHTIVCDQPAENGGFDEGMTPPELMLASLASCAGFYAAQYLKKFKLATEGTKVRVTAEKLKE
    PPRLGIFTIEVDAPVELSEEHRAGVERAVHHCLIHNTLLHPPKIELVVKSLSAV

    >gi|94970110|ref|YP_592158.1| rhodanese/sulfurtransferase-like protein [Candidatus Koribacter versatilis Ellin345]
    MFKLIETSELSGGEQIVDVRTPSEFATGHIAQAVNVPLDQIESRIQDVDPGPIVLVCKGGTRAKIAANLIAPCRSDVAVL
    AGGMDAWYRAGNSVVVNAKTRWSLERQVRFGAGVLVLAGVVASLTVHPRFVFLSAFVGAGLTFAGLTDFCAMGELLARMP
    WNRGSKLSAIRNGNGTVCTVKD

    >gi|94970250|ref|YP_592298.1| soluble pyridine nucleotide transhydrogenase [Candidatus Koribacter versatilis Ellin345]
    MPNGYDYDLVVLGSGPAGQKGAICAAKLHKRVAIVENRWALGGVCVHSGTIPSKTLREAVLYLSGFREKTFYGRSYQVKD
    RVVMADLTFRVDAVIKRETEVIRAQLQRNQVVPLDGYGRFVDAHTVEVESAEGTRRVTSENFLVSTGTRPASDQHYQLDG
    THIFNSDQLLSLSEVPRELIVVGAGVIGLEYASMIAALGVKITILDARPTILDFIDREIMDSLQFQLRQLNVIFRLGEKV
    TTCVYDAERGRVIATLESGKRVHGDGLLFTVGRQANTDKLNLESAGLKTGDRGKLEVNEQFQTAVPNIYAAGDVIGFPAL
    ASTSMEQGRIASCNMFGVPSKMRPQFFPYGIYTIPEISIVGQTEEQLTHDKVPYEVGIARYSELAKGQMLGDEHGLLKLL
    FHSESLKLLGVHIIGERAAEIIHIGQAVLSFGGSIEYFRDTVFNYPTMAEAYKVAALDGLNKL

    >gi|94970465|ref|YP_592513.1| rhodanese/sulfurtransferase-like protein [Candidatus Koribacter versatilis Ellin345]
    MTPARRLMTLPEFWQIVEAAKREIKEITVSDLKHMQQSGEKFALVDVREREEHAKGMIPGAVAIPRGVVERDIEQATTNK
    QQPLVIY
    CAGGARSALAALNLKQMGFENVMSLAGGYTAWDKEK

    >gi|94970695|ref|YP_592743.1| putative thiol-disulfide isomerase and thioredoxin [Candidatus Koribacter versatilis Ellin345]
    MVISKTHLLALFFVAISACAQSRMVLDTPIYPEGVDAKKEIRAALVQAKAQNKHVLLVFGADWCYDCHVLDYRFHSPEIE
    PFLDKNFVVVHVNIGRGETNVDLSNKYHIPVDKGVPSIAVVSPTGALLYSTQHGEISPTRRMPATQIVGMLENWAALK

    >gi|94970762|ref|YP_592810.1| peptide methionine sulfoxide reductase [Candidatus Koribacter versatilis Ellin345]
    MVTRLVGSCVVLGCAMFLAGCNAHATPSSRKAIPAANVDVALASASGKQTAVFAGGCFWGTQAVFERVKGVISTTAGYSG
    GSAATATYDQVTTETTGHAESLEVVFDPSKITYGQLLRIFFSVAHDPTQLNHQGPDVGASYRSAIFYVNDDQKRIANTYI
    AQLDTAKVFPAQIVTEVTPLKGFYRAEDYHQDYALHHPDNPYILVCDRPKIESLKRQFPELFVDYKGRH

    >gi|94970763|ref|YP_592811.1| protein-methionine-S-oxide reductase [Candidatus Koribacter versatilis Ellin345]
    MPTYKRNPDAVSRLSPEQYRVTQTSGTERPFHNAYWDNREPGIYVDVVSGEPLFASIHKFDSHTGWPSFTKPIESENVVE
    NIDVSHGTTETEVRSRHGDSHLGHVFPDGPLAEGGLRY
    CINSASLRFIHFDELENEGYGIYRKIFQTQNKE

    >gi|94970764|ref|YP_592812.1| methionine sulfoxide reductase A [Candidatus Koribacter versatilis Ellin345]
    MNILTERALIAGGCFWGMQQLLRRYPGVISTRVGYSGGDVSNATYRNHGTHAEAIEIIFDPEQLTYRTLLEFFFQIHDPT
    TLNRQGNDRGTSYRSAIFYTSDEQKRIAIDTIADVNASGIWPGKVVTEVEPAGAFWEAEPEHQDYLEYYPNGYNCHFIRP
    DWKLPRRSEKASFSS

    >gi|94970953|ref|YP_593001.1| thioredoxin-like [Candidatus Koribacter versatilis Ellin345]
    MTRKIILVVIVFAVAGVIFWQNRGSKSAAPGQPAASKTTGPQFTVTDLNGKTIDSASLRGKVVLVDFWATWCVPCEGEIP
    HLIEWQDKHANDGFQVVGLSMDDTAGPVKTYVEKKKMQYPVAMADDKTIAAFGGVLGLPVNFIIGRDGRLIARHAGVTDI
    NVLQQEVERALAEK

    >gi|94970954|ref|YP_593002.1| hypothetical protein Acid345_3928 [Candidatus Koribacter versatilis Ellin345]
    MRTLVGFLALIAMSLPCWAADVETKYQVAPEDLVKQMQSAKAPLILNVGPQKLFEQAHIKGSEYIGAGSSAEGIAKLKER
    VKTLPKNAAIVLYCGCCPWDH
    CPNINPAFAALHEAGFTNVKVLFVAHNIGTDWVDKGYPVEKGK

    >gi|94971126|ref|YP_593174.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Koribacter versatilis Ellin345]
    MLGVGQKFPAFNLKATVSLEKGKEFADIKDNDYAGKWKIYFFWPKDFTFVCPTEIAAFGKMNKEFAERDTQVLGGSTDSE
    FVHHAWRTHHDDLRNLPFPMLADVKRELTSDLGILDPEAGVAQRATYIVDPQGIIRFAYVTDLSVGRSPSEVLRVLDALQ
    TDELCPCNWQKGQETLHV

    >gi|94971218|ref|YP_593266.1| alkylhydroperoxidase AhpD [Candidatus Koribacter versatilis Ellin345]
    MLDWNQYQKELGARLKELSGLSPDTLKGYMTLSGANKETTHLGEKTRQLISLAVAVTTRCDGCIVFHTEAAIKAGATKEE
    ISEALGVAVGMNAGAALIYSTRVLDAYAAKTEHAATTAG

    >gi|94971330|ref|YP_593378.1| dihydrolipoamide dehydrogenase [Candidatus Koribacter versatilis Ellin345]
    MPDTIYDVVIIGSGPAGYTAAIRAGQFGLKTALIEKDAKLGGTCLHVGCIPTKSLLFNAEIYDHIKEAEEFGIEGLGTPK
    LNWSKVQERKQAIIDKHAKGLQFLMKKNKVTVIPGFGRLTGPAKGGIHSVEVEADGKKQNVQAKNVLLSTGSVARMLPGL
    QADDRILTNIEILSLKEIPKSLVVIGSGAVGVEFASIYKSFGTDCTIIEMLPRLVPVEDEEVSKELLRNYKKRGINCHVN
    AKTDKFEKTKTGVKVTFTVDGKQESIEAEKCLVAIGRAPRTEGVGIEKTNIKLERGFVPVNEWMQTTEPGVYAIGDIVLG
    LQQLAHAGAMEGMVAVAHIAGKPTKPVRKDRVPGATYCHPEIGSVGLTEAQAKEAGHEVKIGKFPFTANSRASIVNQHEG
    FVKVVADAKHGEILGVHIIGPQATELVAEAVAMLELEATADFMMTVIHAHPTLAEAMLDAVSAVYGMAINA

    >gi|94971435|ref|YP_593483.1| hypothetical protein Acid345_4409 [Candidatus Koribacter versatilis Ellin345]
    MGRQKPDEPADTKSDNKSQAKLPGYCFLQASKSTSHAFASAVTALPGPLRQACFAMKRFLLIVFLLATVVLPTLAGSKKD
    SSSTLPHTYDATRDPAKDLAVAIAEAHATDRNILLDVGGTW
    CKWCGYLDKFFTDHADLRELRDKNFVVMYVNFGADNKND
    KFLAQFPKLKGCPHLYVLTADGKLLKSQDTSDLEDGKSSYVPEKVRAFLTEYGREKQ

    >gi|94971127|ref|YP_593175.1| alkylhydroperoxidase [Candidatus Koribacter versatilis Ellin345]
    MNLEALLDTVPAYARDLKLNFSAVVRQNTELTEQQLWGTVVACAAASRNRTLLDAIVEEAKGKLSAQAVEAAKGAAAILS
    MNNIFYRFQHLAVNKKYETMRAGLRMNFLRQHGVDPLDFELWALAVSAVNGCGK
    CIDAHERVLLQKEFSEEKILAAIRVA
    STIYGLAVVFDAEEPKGDLVGAPVNTDAYSTTTI

    >gi|94971779|ref|YP_593827.1| hypothetical protein Acid345_4754 [Candidatus Koribacter versatilis Ellin345]
    MLSRLSHLALFLALATAFALAGDTSALKPPKGAKVAIIVFEDLQCPDCARAAPLVHEAAKTYKIPLVQYDFPLPQHNWSF
    DAAVNARWFDAKSKEIGDQYRLYCFSHQNEITPDNLRSKSEAFATEHKLTFPTFVDPSGSLTAKVKADYDLGQRVGIVHT
    PTLYVVSNTSRGTPFVEVVDRTQLYTLIDNMLKEADPVPTEKTAAKH