Actinobacillus pleuropneumoniae serovar 5b L20 uid58789

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126207542|ref|YP_001052767.1| glutaredoxin 1 [Actinobacillus pleuropneumoniae L20]
    MFVEIYGRMTCPYCTRAKALAEKMKGELADFDFKFIDMIAEGISKEDLEPRVGKPVATVPQIFLDNVHVGGCTDFQALVK
    EKFGIEV

    >gi|126207561|ref|YP_001052786.1| monothiol glutaredoxin-like protein [Actinobacillus pleuropneumoniae L20]
    METIDTIEKIKKQIGENPILLYMKGSPKFPSCGFSARAGEAVINCQVPFGYVDILTNPDIRAELFANWPTFPQLWVEGEL
    VGGCDIVLEMFQKGELQTLLKEVAAKHA

    >gi|126207567|ref|YP_001052792.1| thiosulfate sulfurtransferase GlpE [Actinobacillus pleuropneumoniae L20]
    MSETFTEISPHQAWELIENEGATLADIRDGRRYAYSHPQDAFHLTNESYGRFLDEVDYEEPVIVMCYHGVSSRNTAQFLV
    EQGFDRVYSVKGGFDGWERSGLPIETAY

    >gi|126207572|ref|YP_001052797.1| thioredoxin reductase [Actinobacillus pleuropneumoniae L20]
    MTVKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTDEIENWPGEYEHTTGTGLMDKMLKHAEKFNTEIV
    FDHINSVDLSKRPFTLKGDINTFTCDALIIATGASAKYLGLPSEEAFKGKGVSA
    CATCDGFFYRNKPVAVVGGGNTAVEE
    ALYLANIASEVHLVHRRDSFRAEKILLGRLQKRVEEGKIILHTDRTVEEVLGDNMGVTGVRLASTKDESKEEIKVDGFFV
    AIGHAPNTAIFDGQLELDNGYIKVKSGLEGNATATSVAGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEA

    >gi|126207641|ref|YP_001052866.1| Na(+)-translocating NADH-quinone reductase subunit D [Actinobacillus pleuropneumoniae L20]
    MASNNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAIAVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIAS
    LVILVDQILRAYAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAMLIIVAFLRELIGSGKLF
    GVTILQTVQDGGWYQANGLFLLAPSAFFIIGFVIWGIRTWKPEQVEK

    >gi|126207642|ref|YP_001052867.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus pleuropneumoniae L20]
    MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVYTHVLKDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVN
    CAIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGL
    TEKMKYSDVPAGLRGLGITFITVGLMALGFMSFSGIQL

    >gi|126207653|ref|YP_001052878.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus pleuropneumoniae L20]
    MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYVLIPLEAQFLRTLVFILV
    IAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTN
    CAVLGVALLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAA
    ADVPRPFQGASIALITAGLMSLAFMGFTGLVKI

    >gi|126207654|ref|YP_001052879.1| electron transport complex protein RnfB [Actinobacillus pleuropneumoniae L20]
    MYILIAIAVIALIFGAILGYSSIKLKVEADPIVEQIDALLPQSQCGQCGYPGCKPYAEAIANGDQITKCVPGGQPLVVKI
    ADLLGVEVPAMDGVAEPEVKVALIHEDMCIGCTKCIQACPVDAIIGTNKAMHTVIPDLCTGCELCVAPCPTNCIEMVKQQ
    TTTKTWNWQFDENLVIPVVNTTELQKKLVIGGGKNE

    >gi|126207659|ref|YP_001052884.1| electron transport complex RsxE subunit [Actinobacillus pleuropneumoniae L20]
    MNTENQIPVTEIDTTTPAEPSIWRNLLAEGVWKNNGALVQLLGLCPLLAVSNNVTNALGLGLATLLVLVCTNTMVSLFRK
    FTPTDIRIPIYVMVIATVVTAVQLLMNAFAYPVYQSLGIFIPLIVTN
    CIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLS
    LVALGAMRELIGNGTLFDGLDLLLGDWAKSLRIDVLHLDSGLLLAILPPGAFIGLGVILAVKNLIDKK

    >gi|126207795|ref|YP_001053020.1| molybdopterin biosynthesis protein MoeB [Actinobacillus pleuropneumoniae L20]
    MELSDQEMLRYNRQIILKSVDFDGQEKLKASRVLIVGLGGLGCSAAQYLASAGVGHLILVDFDEVSLSNLQRQILHTDAN
    IGQLKVESAKVRLSQINPHIQLEAINKQCSDAEFAELIERVDLVVDCTDNVTVRNQLNLQCFAQKRPLVSGSAIRFEGQI
    SVFTYAENEPCYNCLSRLFGDGTLS
    CVEAGVIAPIVGVVGSLQALEAIKLLLNIGKSLSGKLLMIDGLYFSVREMNLPKL
    QDCEICCQ

    >gi|126207805|ref|YP_001053030.1| disulfide bond formation protein B [Actinobacillus pleuropneumoniae L20]
    MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCVYERLAIFGLLIAGLVGAISPRFFLTRWLALLLWGF
    SAFKGLALAIKHHDYQANPSPWNQ
    CEFKPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFV
    IVLLSQFKRAKPQYRSVFR

    >gi|126207917|ref|YP_001053142.1| methionine sulfoxide reductase B [Actinobacillus pleuropneumoniae L20]
    MIKDIDELTEEQVEILINHGTEMPYSGKFLNENRIGTYRCARCHNALFRSDTKFDAGCGWPSFYEAISDDALRYLDDYSL
    GRHRTEIRCGNCDSHMGHVFNDGPPPTGLRF
    CLNSIALNFKWDETGEEIDG

    >gi|126207942|ref|YP_001053167.1| thiol:disulfide interchange protein DsbC precursor [Actinobacillus pleuropneumoniae L20]
    MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDSALPGFRTAVSSEGVVQISENGRFVIQGQIFELKNG
    KAVNITNKSLLADLNALEKEMIIYPAKNEKHVVTVFMDIT
    CHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQME
    AIWTSADKVKALTDAENGTLPKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEPKELLKMLSE

    >gi|126207961|ref|YP_001053186.1| hypothetical protein APL_0477 [Actinobacillus pleuropneumoniae L20]
    MFTNWKEQTQITKQAFGKMAQAHPKMLQAMGALNAASAEEGLDAKTRELIALAVAITTRCESCISVHAEAAIKAGATDKE
    IAGALATAIETNAGAAYAYALRAFEAVETQR

    >gi|126208015|ref|YP_001053240.1| molybdopterin/thiamine biosynthesis dinucleotide-utilizing protein [Actinobacillus pleuropneumoniae L20]
    MLDCSDNMATRHAVNKVCVENQIPLISGSAVGMDGQLLGVFPPYQHGCYACLFSDTEIGNLNCRTAGVLAPIVGIIGSLQ
    ALEALKFLLGLPVSCDGKFGVFDGRSLMWQQIEMVKDKRCRVCGTL

    >gi|126208249|ref|YP_001053474.1| dihydrolipoamide dehydrogenase [Actinobacillus pleuropneumoniae L20]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHAEKNGITFGEPN
    IDLDKVRAGKEAVVSKLTGGLAGMAKARKVTVVEGLAAFTDPNTLVARDRDGNPTTIKFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVAIYTKQIEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVNVDDRGFIAVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRLLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKR

    >gi|126208322|ref|YP_001053547.1| thioredoxin-dependent thiol peroxidase [Actinobacillus pleuropneumoniae L20]
    MNTLKAGDKAPQFTLLDQHEQPVSLSQFIGKKVLVYFYPKALTPGCTTQACGLRDSKSELEQLNVVVLGISPDLPKKLAQ
    FAEKKALNFTLLSDADHQVAEAFGVWGEKKFMGRTYDGIHRISFLVNEQGVIEQVFDKFKTGEHHQIVVDFVKGTK

    >gi|126208405|ref|YP_001053630.1| iron-binding protein IscA [Actinobacillus pleuropneumoniae L20]
    MAITLTETAANRVRTFLENRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFEQHGVKVIVDEKSLTYLDGTELDFV
    KEGLNEGFKYNNPNVKDSCGCGESFNV

    >gi|126208410|ref|YP_001053635.1| methylated-DNA--protein-cysteine S-methyltransferase [Actinobacillus pleuropneumoniae L20]
    MKSTIYYQYYDSLVGKLLLIANDKGLIGIEFEQEQLTSDAQKWQEANETSGQIFEIFCKTRDILDRYFAGEKLEFRHLDF
    LAPQGTEFQKSVWQILLTIPYGKTTSYGEIARQLGKPNAMRAVGGAVGRNPISIIVP
    CHRVLGKSQTLTGFGGGLPAKRY
    LLALEGIHFKDKGIEFVNPKHKKWDKA

    >gi|126208498|ref|YP_001053723.1| peptide methionine sulfoxide reductase MsrA [Actinobacillus pleuropneumoniae L20]
    MANIREIYLAGGCFWGTEAFMQRINGVLDAQSGYANGNTENPSYQEVCAGSGHAEVVKVTYDADKISLAKLLDYYFKVID
    PVSVNQQGEDKGIQYRTGIYYVDPQDIPVINQALADLQTQYEQPLVVENTMLEHYFPAEEYHQDYLDKNPNGYCHIDLQL
    MNEILRNQ

    >gi|126208523|ref|YP_001053748.1| disulfide bound formation protein E (dsbE) [Actinobacillus pleuropneumoniae L20]
    MKKTFLFLPLLLLIALVAFLTVPLMNKDALSPTEDWRDKPFPEFVGKNLLEHNAHINNNSLPKEPYILNVWASWCTWCIK
    EFPILLKLKEQGVPIVGLTYSDQPKDAREALARWGNPFDLVIDDYEKGFLIQTLKVSSAPSSYLIDKHGVVRYQQKGYNP
    DFEQDFLPRLKALQEEK

    >gi|126208545|ref|YP_001053770.1| hypothetical protein APL_1073 [Actinobacillus pleuropneumoniae L20]
    MSKFQIHTIETAPEASQEALKAVKQANGFIPNLIGVLANAPTALETYRTVSGINGRNSLTPLEREVVQITAAVVNGCGFC
    VAGHTKISLKALNAPKEIVDQIRATARISDPKLDTLARFTLAVMLQKAKLTEAQLNEFFAAGYNQQSAIEVILGVSLATL
    CNYANNIAETPINPELQDFA

    >gi|126208550|ref|YP_001053775.1| thioredoxin [Actinobacillus pleuropneumoniae L20]
    MTLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDENQQIPAQFGIRSIPTLILFK
    NGEVVATQVGALPKSQLSAFVEQAL

    >gi|126208561|ref|YP_001053786.1| arsenate reductase [Actinobacillus pleuropneumoniae L20]
    MEKVTIYHNPKCGTSRNTLALIRHLGIEPTIIHYLETPPDEVTLRNLISEIGIRVRDLLRTNVPPYETLNLSRMELSDDE
    LIAAMLAEPILINRPIVITSKGVRLCRPSEKFLEISPVSLDKPFIKEDGGVIEL

    >gi|126208692|ref|YP_001053917.1| hypothetical protein APL_1224 [Actinobacillus pleuropneumoniae L20]
    MQKLLFIFNSAPYGNESFFSGLRLALQIQEQHKAQLKLFLMSDSVTAALRKHNPSEGYNLQQMLEILTAQGATIKLCKTC
    INARGMSALPLADGVEIGTLIELADWTMEADKVLNF

    >gi|126208709|ref|YP_001053934.1| glutathione reductase [Actinobacillus pleuropneumoniae L20]
    MTKHYDYLAIGGGSGGIASINRAASYGKKCAIVEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINSYAPDYGFDVTVNNFD
    FVKLIESREAYISRIHTSYNNVLAKNNVDVLNGFAKFVAAKTVEVTYADGSSEQVTADHILIATGGRPSIPAIKGAEYGI
    DSDGFFALREVPKRVAVVGAGYIAVEIAGVLNSLGSEMHLFVRQHAPLRMQDPLIVDTLLEVLAQDGITLHTQAIPQEVR
    KNADGSLVLTLADGREATVDCLIWAIGREPACDKINLDAVGVKTNAKGQIIVDKFQNTNVPNVYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPNEHLDYNLVPTVIFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCRMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|126208730|ref|YP_001053955.1| putative cation transport ATPase [Actinobacillus pleuropneumoniae L20]
    MSITLKLGGLHCGNCVKSVEKALNAVEGVTKATVTLDPQQAIVEGSASAEALIAAVDDIGFEAEVI

    >gi|126208731|ref|YP_001053956.1| copper-transporting P-type ATPase [Actinobacillus pleuropneumoniae L20]
    MAKEQQLLIDGMHCAACVRRVEKILMKVEGVTFASVNLADQTAFVQGEADPQAMVQAVEKIGFGAEILESEQERRAKQQA
    QTQRTLSHKKWQFIMALIVGFGLVVLGLVIGMIPNSTNLMYWFIAAAVSLFTMYFAGKDFFIGAWVSLKNKASTMDTLVA
    LSTGVAWLYSFWLTLFPQPQAHVYYEASVMIIGFINLGKFLELKAKQRSSLALEKLLDLAPQQAVVFDRNNAAQTIPVKG
    IKPEMRVQALTGDRLAVDGRLESGSIWVDESMLTGEALPIEKKVGDKVRAGTLIQDGAGIYIAEQVGSQTALARVINAVR
    HAQSSKPPLAQFVDKVASVFVPVVVSIALISGLVWLFLGKDFSFALSIFTTVLIIACPCALGLAIPLSTIAGVARAAEFG
    VLVRNIEALQASSEIDTLVFDKTGTLTTGEMTVSDIQTFNGFEPNRVLQLAKSLEVHASHPIAKAIVKFAENQTACEVTN
    VQVVKGAGIVANLGGDQIKVGNAKFVNFSGNLTASRATQIFVAVNDQLAGILSVEDQLCDESKAVIEKFKAQGYQCLMLT
    GDRQATAEYFAQQLGLDGVIAEVLPEQKADKIRELQAQGKKVAMIGDGINDAPALAQANVGIAMHNGSDIAVETADLSLM
    QHGLAPVLQILPFAKRVLRNMKQSLLGAFMYNVIAIPLAAGVLYPFTGWLLNPMIAAIAMTMSSITVVLNSQRLLK

    >gi|126208750|ref|YP_001053975.1| putative DNA-binding protein [Actinobacillus pleuropneumoniae L20]
    MFQDWKAHTAHVKKSFGALGAKHPKMFEAYQALGAAAAAEALDHKTRELIALAVAVTTRCDSCISVHAEEAAKAGATESE
    IAGALATAIALNAGAAYTYSLRALEAVAVQDE

    >gi|126208751|ref|YP_001053976.1| hypothetical protein APL_1285 [Actinobacillus pleuropneumoniae L20]
    MNKLTYLLGALVLATPVLTQAAEMKETEQTMQNAPLKAKGIWIDVRTADEFQQGHLDGSINIPFEQIADHISKVSPNKDE
    PVHLY
    CRSGRRAETALQTLKQLGYNNVTNHGGYQELIEKGYK

    >gi|126208823|ref|YP_001054048.1| thiol:disulfide interchange protein precursor [Actinobacillus pleuropneumoniae L20]
    MLKRFIFLLVGITLTLSAHAGLFGNDQPKYLSGAEAFAFSATPKSDKQIELNWQIADGYYLYKKEIQVTPQNAEIQPLAF
    PAAENYHDEFFGEVEIFRNQLTLPITFSAEQANASLSVHYQGCTKGFCYPPETVTVSLDGQQAVDSAQNVAKNRENSTAS
    QPLANAPKAEQDQLAENLANNRLSIFWFFLLGIGLAFTPCVLPMLPLLSAIVIGNKQRPNTFKALLLSFAYVQGMALTYT
    LLGLVVAAIGLPFQVALQSPPVLISLAILFTILAASMFGLFEIRLPNSWQQKLNAMSQKQQGGAFGSVFVMGMIAGLVAS
    PCTSAPLSGALLYVAQSGDLLTGGLALYLLALGMGIPLILITLFGNRILPKSGDWLLKVKTAFGFVMLALPVFLLSRILP
    SHYEPLMWSALAMVFVGWLISVIPTQGVIKQAVRIVLFLTFAVASYPWANLVWNQGNSSHSAQVSNHLAFERVQSLAELQ
    EKLTASQGKKVMLDLYADW
    CVACKEFEKYTFTDQAVQQKLAEMVVLQVDMTNNSAQNDELMKHFNVLGLPTILFFDESGK
    ELTQSRVTGFLEANQFLNWLNQL

    >gi|126208926|ref|YP_001054151.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus pleuropneumoniae L20]
    MSNIQIPLIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQINEGDLTIENQNVGLVVDPMSLQYLIG
    GTVDYTEGLDGSRFVVQNPNASSTCGCGSSFSI

    >gi|126208943|ref|YP_001054168.1| thioredoxin-like protein [Actinobacillus pleuropneumoniae L20]
    MQNKYAMLSRFGKNIFFYGLMFIVLSTVIDWYRKPSAPNQFAQQVLYDLQHQPKMIAQLSHDRPMLLYFWGSWCTYCKFT
    SPAIQQFADENVSVLSVALKSGTPQDVVDYLKQEDYRFPVINDPDGVISKSWDIQVTPTVLIIKDGEIVQHTTGLTSYWG
    LKVRLWLSNLT

    >gi|126208946|ref|YP_001054171.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae L20]
    MSLKDMTGQKVPNVTFHTRQGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHLPRYNELACEFKAAGVDDILCMSVN
    DTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTM
    MKYLVQGWAPKESVSIITKPG
    CPFCAKAKALLKEKGYTFEEIVLGRDASTISVRAITGKTSVPQVFIGGKYIGGSDDLAA
    YFAK

    >gi|126208953|ref|YP_001054178.1| thiol peroxidase [Actinobacillus pleuropneumoniae L20]
    MSNVTLMGNPITVAGIFPQVGDTVADFSLVNNGLENVALASFAGKRKVLNIFPSIDTGVCATSVRVFNQKAADLSNTVVL
    CISADLPFAQARFCGAEGIENVQTLSTFRNKAAHNALGVDIQSGPLAGLTSRSVIVLDENNRVLHSELVSEIKNEPNYEA
    ALAVLA

    >gi|126208978|ref|YP_001054203.1| thiol:disulfide interchange protein DsbE [Actinobacillus pleuropneumoniae L20]
    MNKKLLLPLIIFLGLTVTFMVQLSRNAQGDDPKKLESALVGKTIPDFRLESLLDEKQMLDQNVLKTGTPRLLTVWATWCP
    T
    CYAEHEYLTLLAKQGVEIVGVDYKDERSKAMRFLASYGNPYKANIYDPKGSLGLDLGVYGAPETFIIDGNGVIHYRHAG
    DVNDQVWNQVLKPIYEKLKQ

    >gi|126208988|ref|YP_001054213.1| glutathione S-transferase [Actinobacillus pleuropneumoniae L20]
    MKLYCLKGACSFVPHVALEWTGAEYQAELVSRDFIKSAEFLALNPRGAVPLLVDGDLALSQNQAILHYLDEKYPDAKLFG
    SKTLRDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNEELTRVICQQAAEQVLSQLATANEHLESHIFFGENISVADVY
    LYIMLNWCRMLGLDFSHLEQLSPFMQRVEANAGVDAIRVAEGLKG

    >gi|126209102|ref|YP_001054327.1| thiol disulfide oxidoreductase [Actinobacillus pleuropneumoniae L20]
    MLCEKLIKWVTFIFALVITCNAAATLPQAVEKIPKNVKNEPLFKDGKGYYSYKKPIDIELPKDGRVLIQYFFKYDCNICL
    NADDYLKQYARLHSDQVILQRSPVYDGNDIFTGQMHATFMQFGREDLSDLFLFDSAGRKESMSLVKSNDAIVQWLTSKGI
    DAQAFNRLFHSDEVKNRMKQAQTLFNKYKPPYVPIAVLNGKYILLQNTLYNDDYTYGVLDFLVNKLQQEQKEETK

    >gi|126209106|ref|YP_001054331.1| sulfur transfer complex subunit TusD [Actinobacillus pleuropneumoniae L20]
    MDYVLAVKSPVYGDQGAYLAYQVAESLLASEHNIKQVFFFQDGVGNANALVNPASDEINLVEKWQELAKLHDLPLHLCIS
    AAQRRGVVDNQTSKIQQSNLADGFILAGLGEFSQAVLKADRLLTF

    >gi|126209318|ref|YP_001054543.1| hypothetical protein APL_1856 [Actinobacillus pleuropneumoniae L20]
    MSLSQKNSNNRFFASLTAALVAAVSSTLCCIAPLVYLVFGISSPWLVSLSEYEYLQLPLLFVSLGAFGYGFWLLMFSKKI
    ICTKYCSRRTLMILYWIAFAIILFFLSYPFILPWLLA

    >gi|126209330|ref|YP_001054555.1| Thiol:disulfide interchange protein dsbA precursor [Actinobacillus pleuropneumoniae L20]
    MKKLALKSVLVALSTFFAVNSTAIAADPVEGKEYTQVRQAPSAQKEVVEFFSFYCPHCYDFELTYKIPSQIKQALPKDAK
    LVQYHVNFLGRQSENLTRAWALAMALGAEDKVKTALFEAAQKDAMKSMDDIKAVFTANGVSAADFDNGINSFAVNGLVNK
    QVQLAENFKIRGVPAFFVNGQYQINLEGFADSASTNEFVKRYVEAVTFLIKK

    >gi|126209336|ref|YP_001054561.1| ArsC protein [Actinobacillus pleuropneumoniae L20]
    MTIRVYGIKNCDTVKKALKWLTDNNISHQLHDYRIDGLSVDFLQHAETAFGWESLVNKRSTTWRNLDEAVKNNLDRATAL
    KVLQDQPTLIKRPIILQDGIALIGFDAKQYEQAFGK

    >gi|126209431|ref|YP_001054656.1| putative inner membrane protein [Actinobacillus pleuropneumoniae L20]
    MLEIWQQFKQTYLIKFWNPVPAVIAAGILSAYYFGLTGTYWAVTGEFTRWGGEILQLLGVDVSGWGYFNFISLDGTILNR
    IDGLMILGMFAGCIAAALWANNMKIRMPQNKIRILQALIGGALAGFGARLAMG
    CNLASLFTGIPQFSMHAWYFTLATAIG
    TYAGVKFTLLPMFRPPLKLKKGAGKVEASNPKQAQFRFWIGVAVFTAWTIASIYVLQYSIKLGFAMLFGLGFGLLIERAQ
    ICFTSAFRDLWVSGRSHMGKAIIYGMLIGTICVFSYIQLGMEPKIMWAGPNAIIGGLLFGFGIVLAGGCETGWMYRAMEG
    QVHFMWVGVGNVIGSTLLAYLWDDLAPVLALDYEKINLLKSFGPVSGLLINYALMIACLIFIVWWEKRFIRKAKVRVAAT
    NTYTIN

    >gi|126209499|ref|YP_001054724.1| thiosulfate sulfurtransferase [Actinobacillus pleuropneumoniae L20]
    MKLKLSALAVALSLLAGCNEQKIGEISQTELLKQKDNPEFLIIDTRGDTFYNGFKSQQTARGGHIPNAIQFTAEWVEAIH
    PDYFESFASDKGITKDKTLVLYDDNLDNLEKVSAEFIAKGYKVKLFKDFVKYTQDPTAPLEAFPNYHWLVSAQWLKDALD
    GKKPETDSGKEIMVFHVSWGPLEQAQGYKQHVSGAYHFDTDWIENGPVWNLSAPDIVEKNLLKNGITKDKTVVLYSENQL
    AAFRVLWALKWAGVEDVRILNGGVNAWINNEYPIDTTTNIPTPETDFGTKIPANPQLTIETAQQAYAKQKEGVKLVSIRA
    WDEHLGKISGYDYIPGKGEPEGAIWGYAGTDSSNVADYYDPDGSLRNPKEIFALWEQQGIKPNDHLAFY
    CGTGWRAGIPW
    FMTQMAGWKNAVVYDGGWNAWQMDGSLPTKTHSTVTKPNAKNFFGVTPRSGLSCKS

    >gi|126208546|ref|YP_001053771.1| thiamine biosynthesis protein ThiI [Actinobacillus pleuropneumoniae L20]
    MKFIIKLFPEIMIKSDSVRKRFIKILTSNIRNLLLRETENVAVIRNWDFIEVRAKVAEEAPLVLELLKRTPGIHHILEVE
    EMPFTTMHDIFENTLAKVRDELEGKTFCVRVRRKGKHEFRSLDVEKYVGGGLNQHIESARVKLTKPDVTVRIDIDGDKML
    LINARHEGLGGYPIGTQEDVLSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGAAHEIGVKQMAYHIWSRYSTSHKVRFV
    AINFENVVGEILEKVDNGQMGVVLKRMMVRAASKIAERFDIQAIVTGEALGQVSSQTLTNLRLIDKASDTLVLRPLITHD
    KEQIIAMAKEIGTDDIAKSMPEFCGVISKNPTVKAIESKIVEEEGHFNFEVLEQAVANAQFLDIREIAQQTEQEVVSVET
    TSELTENDIILDIRSPEETDEAPFSLDGIEVKLMPFYKLSSQFASLDQSKNYLLY
    CQRGVMSKLQALYLKENGFSNVKVF
    RH