Candidatus Hamiltonella defensa 5AT Acyrthosiphon pisum uid59289

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238897305|ref|YP_002922982.1| Fe-S cluster assembly protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MQQNKLDIFETAHHQWSGVTMTARAAAQIIKLMKKNEKIKGLKLSVKPSGCAGFAYVMNMVESTANDDLLFEQKEAKLYV
    PLKAMPFVDGTEMDYVSEGLNQMFKFNNPRAQHACGCGESFGV

    >gi|238897324|ref|YP_002923001.1| tRNA 2-thiouridine synthesizing sulfurtransferase D [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MKKLSYCLLVTGPPYGTEQASSAYQFAKALLDTKHRLISIFFYQDGVFNANRFVTPASDEFDLVRAWHQLALDHHIMLNV
    CISAASRRGVGCLQQEQIQSYSSSYNLQNGFTLSGLTALVEALLTCDRVIQF

    >gi|238897327|ref|YP_002923004.1| putative sulfurtransferase, rhodanese-like domain protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MPVLHNRISNQKLKEKMLAETQERQTLSFYKYFALDNPSMFRDKLYTQWNQLSVFGRVYIAKEGINAQISVPIDHYNDFK
    ASLFNAHPALDQIRLNTALEDNGRSFWVLRMKVRQRIVADGIEDETFNPAHTGQYLKAHEVNEMIKDPDALFVDMRNHYE
    YEVGHFKNAIKVPSDTFREQLPMAVDMLKEDKEKKMVLY
    CTGGIRCEKASAYLLHHGFKNVYHVEGGIIEYVRTAKKKDL
    PLHFIGKNFVFDERMGERVSEEVIAHCHQCEQFCDTHVNCHNSACHLLFIQCAICSEKFSGCCSAICQEELELSPEEQRL
    RRSARGNKIKIFNKSKDVLETIMNKSIIDQGNKEG

    >gi|238897333|ref|YP_002923010.1| alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MTLVTYIAPDFTAPAVLENGEVTENFNFWSYIKDKPCVLFFWPMDFTFVCPSELIAFHERNEAFKNRNTKLVGVSLDSHF
    VHKQWRNTPIEKGGIGKVSYPLVADIKREIQKGYGIEHPEAGVALRASFLIDENRVIRHQVVNDLPLGRNVDEMLRMVDA
    LAFHQTHGEVCPAQWEEGKSGMQASSDGVAKYLSEHVSDLKRSSTKS

    >gi|238897337|ref|YP_002923014.1| thioredoxin 1, redox factor [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MSKEIIQLSDKSFDRDVLKADGLILVDFWAQWCGPCKMIAPILDEIANEYVDKITITKLEIDTNPNTTQKYGIRSIPTLL
    LFKEGKPIDTKVGAVSKHELKKFLDKHV

    >gi|238897339|ref|YP_002923016.1| glutaredoxin 1 redox coenzyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MFIVIFGRPKCPYCTRAIELAQKLKSELKDKNINFDYIDMHAEKITKADLEKTVGKPVETVPQIFIDKQHIGGYTEFAAY
    VNKHFHDLKF

    >gi|238897341|ref|YP_002923018.1| arsenate reductase-like protein, ArsC domain protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MYTLYGIKNCDTIKKTRSWLNEHHVIYRFHDYQVDGLTPGALQNFIACLGWTPLLNTRGTTWRRLSETERAEIRDAASAH
    SLMLQKPAIIKRPILESSNGVLLLGFNIEQYRHFLKHS

    >gi|238897364|ref|YP_002923041.1| thiol peroxidase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MTQTVLFQGKETRVSGKFLEPGNKAPSFKLVGKNLSEHSLSDFAGKNKILNIFPSIDTGVCAASVRRFNESAAELRNTVV
    LCISADLPFAQSRFCGAENLNNVITLSAFRDNSFKHAYGVDISEGMLKGLTARAVLVLNQQDEIVYSELVSEMTTEPNYE
    AALDALKKL

    >gi|238897582|ref|YP_002923261.1| hypothetical protein HDEF_0354 [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MNHPTRLPLDFTEAAARKFKELIANEHNSNKKLRVYVEGGGCNGFKYMFTLDDKVNEGDLAINKQGVSLVVDPLSLGYLI
    GGIVDYVESIEYSRFIVKNLNAKTTCGCGSSFSV

    >gi|238897600|ref|YP_002923279.1| soluble pyridine nucleotide transhydrogenase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MKTHFNFDTVVIGSGPGGEGAAMGLAKKGQSVAVVERYKNVGGGCTHSGTIPSKALRHVISRIIEFNQNPLYSEHLQSIH
    PSFYHILQHANHVIRKQVSMRFDFYQRNHCHLFFGHARFIDPYKLEVIRPDGTLNTLSADHIVIATGSRPYHPESIDFTH
    PRIYDSDSILELKEEQQPKHIIIYGAGVIGCEYASIFRGLGVKVDLINTRNHLLAFLDQEISDALSYHFWNNGVVIRHNE
    EFDLIEGLDQGVVVHLKSGKKVKADCLFYANGRTGNTKELLLENIGLRTDERRFLQVSNLYQTALSHIYAVGDVIGYPSL
    ASAAYDQGRIASQAITQGINSVRLIENIPTGIYTIPEISSVGKTEQELTDLKVPYEVGRAQFKHLARAQIAGMEAGSLKI
    LFHRESKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIDYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|238897985|ref|YP_002923665.1| putative sulfurtransferase, rhodanese-like domain protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MLQELIPFIDRHPILSVTWVTLLIGVILTFIKNYFSKVKEIIPTEAILMMNKQQALVVDIRAKEEYKKSHIIGSINVEKN
    NLKNNKLYELEKHKARPIIIV
    CAHGVSSLTFAKQLYKMDFQKIYSLKEGISGWNKANLPLAKGKKK

    >gi|238898148|ref|YP_002923829.1| TrbB conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MHSKPFFTHLIGNLMTTRIGDADRGSVLFTCSLGKEPHFFIRQNSLIFRQKHQKDLVLFSDSESPDKAQHLLNALTEALV
    RRQKTKLFWRNLFFGLSLLALLAIGSHGLLSETHTTDNTPLTRTDSASAPLLPEEHAIEKSLMQEPSPALTTLAHNLRDA
    AQRKIFTVPLTTGHSRTIYVFLDPL
    CPHCRDLEPTLEAIGKKVNIEIFPVSLIGKKATAEQVIPVLCASPEHRKALWHSL
    FDDPPLTPSASCDIGEKALAVNDKAFSAYGFRGTPQLISDDGRPIPFSALKNEDTLSSFMNAEPQEKKDE

    >gi|238898499|ref|YP_002924180.1| methionine sulfoxide reductase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MYSLHSLRVEMKIKKLNKIQNDVTQQSGTEPPFSAKLLNNKKEGIYSCLCCSTPLFSSDNKFDSECGWPSFNQTIHDQVI
    KYNHDFSHGMKRIEVRCAHCDAHLGHVFPDGQKPTGQRY
    CINSAALSFTDKKSGEIIEG

    >gi|238898582|ref|YP_002924263.1| putative glutaredoxin [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MTTVEKIQFQIKNNLILLYMKGSPKMPSCGFSAQAVNILSACGERFAYVDILQHPDIRVELPKYANWPTFPQLWINGELV
    GGCDILTEMHQKGELKELLQFQYQEKLSPITGDKESK

    >gi|238898610|ref|YP_002924291.1| oxidoreductase that catalyzes reoxidation of DsbA protein disulfide isomerase I [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MLQLLKCYSERRCIWFFIALTGFCFLLIALYFQYILLISPCVLCIYQRCAFLGLIGASLLAAIYPKSLLRHLGILLWIYS
    AAKGLQFAWEQVKIQSDPSPFHS
    CVLLMDFPSWLSLDKWLPFLFAPYSDCASQQWQLMSLDMAQCLIGIFAIYLFIGGII
    LISQFVKPGRHHLS

    >gi|238898631|ref|YP_002924312.1| periplasmic protein disulfide isomerase I [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MTKIYVLLISFLMTFCVCAAQFQTDKQFQAGNQYIVLDTPAKNNVPDVLEFFSINCPHCYVFDQQYHISDTLEKNLPKGV
    KLARYHVSFLGPLGKELTRAWAVAVKLNAEKKVLPLFFKAAQETKTLSTQEDIRQIFIQAGVTQEEYDGAWNSIPVSALV
    DKQERTVSDLKLQGVPAVFVKGKYMIKNENIDTSSKEAYAKEYAELVGFLLKK

    >gi|238898964|ref|YP_002924646.1| lipoamide dehydrogenase, E3 component is part of three enzyme complexes [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MNEHYDYLVIGGGSGGIASVNRAALYGQKCLLVEAKALGGTCVNVGCVPKKIMWHAAQIAEMIHSYGPDYGFDTTLNAFS
    WQTLIKNRTAYIERIHQSYQRGLAKNKVDVVKGKARFIDAHTVEIATEKDHPAKKIVTADHILIATGGRPKHPDIPGAAY
    GIDSDGFFALKEPPKRVAVVGGGYIALEIAGVLNALGVETHLLVRHEAPLRHFDGLIVSTLLEIIHNSTLKLHTKTQVAQ
    VIKNPDSSLTLRLKTEDALTVDEIIWAIGRDPQIDQLNLSAAGIRMNDQGYIAVDKFQNTTQPGVYAVGDNTGAAALTPV
    AVAAGRRLSERLFNHKPDEHLDYTQVPTVVFSHPPIAMLGLTEEQAKEKYNAQAIKVYTSSFTPMYSAMGSHRQPCRMKL
    VCLGSEEKIVGIHGIGFAVDEILQGFAVAMKMGATKKDFDQTIAIHPTVAEEFVTMR

    >gi|238899080|ref|YP_002924762.1| dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate d
    MKNTQVKTQVVVIGAGPAGYSAAFRCADLGLETLLVERYATLGGVCLNVGCIPSKALLHVAKVISDTKTLEEHGVSFGAP
    KIDLKKMVGWKNNVIQKLTGGLSGMAKMRQVKVITGEAQFSGSHTLLVKTQNAEQTEIRFDNAIIAAGSSAIELPFIPHE
    DPRIWNSTDALKLETIPKRLLVMGGGIIGLEMATVYQALGSEIDVVEMSDQLIPAADKDVIKIFTKKIEKKFNIMLQTKV
    TQVKAQEDGIFVTMEGNQDPEEHRYDAVLVAIGRKPNGKSLNAEKAGVTVDERGFICVDKQLRTNIPHIFAVGDIVSQPM
    LAHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKQKGIEYEIAIFPWAASGRAIASDCSEGMTKL
    IFNKKTGRIMGGAIVGSNGGELLGEIGLAIEMGCDAEDMALTIHAHPTLYESVGLAAEIYEGSITDLPNSKAKKSKA

    >gi|238899240|ref|YP_002924923.1| methionine sulfoxide reductase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MKTKKLNHIQNHVTQQSGTEPPFSGKLLNNTKEGIYSCLCCDTPLFSSDNKFDSKCGWASFNETIHAQVIKYNHDFSHGM
    KRIEVRCTHCDAHLGHVFPDGPKPTGQRY
    CINSAALSFTDKKSGEIIEG

    >gi|238899252|ref|YP_002924935.1| bifunctional transcriptional regulator of DNA repair (N-terminal); O6-methylguanine-DNA methyltransferase [Candidatu
    MSIYFSVGGCSLGKVLVAQSAFGVCAILMGDDETLLMNELKAIFTRETLLENHGLLKPHLGQVSHFIDSPMDKIAFPLDI
    QGTLFQLSVWQALRDIPFGETLSYRDMARKIHRPDAVRAVANACASNHLAVVIP
    CHRIIRTDGTPSGYRWGIDRKRQLLA
    NEARCLYDA

    >gi|238899360|ref|YP_002925043.1| TrbB conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
    MHSKPFFTHLIGNLMTTRIDDADRGSVLFTCSLGKEPHFFIRQNSLIFRQKHQKDLVLFSDSESPDKAQHLLNALTEALV
    RRQKTKLFWRNLFFGLGFLALLAIGSHGLLSETHTTDDIPLARADSASAPLLPEENAIEKGLMQEPSPALTTLAHNLRDA
    AQRKIFTVPLTTGHSRTIYVFSDPL
    CPHCRDLEPTLEAIGKKVNIDLFPVSLIGKKATADQVIPVLCASPEHRKALWHSL
    FDDPPLTPSASCDIGEKALAVNNKAFSAYGFRGTPQLISDDGRPIPLSALKNEDTFSSFMNAEPQEKKDE