Candidatus Desulforudis audaxviator MP104C uid59067

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|169830310|ref|YP_001716292.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Candidatus Desulforudis audaxviator MP104C]
    MPDKIGSVMVVGGGIAGVQASLDLAEAGYYVYLVEASTAIGGTMAQLDKTFPTNDCSMCILSPKLVECDRHPNIEIITLA
    NLIDLQGEAGNFKATVFQKPRYVDADKCVACGDCAAKCPVKVSDEFNEGLEIRKIIANKYPQAVPNTYAITHPEKCLYLT
    KGVQTGKPVCLLCQKACGKDAINWEDKEKTFSLDVGAVILAPGFDEFDPKTIKTLGYGTLKNVVTSIEFERILSASGPFQ
    GHVVRPSDHQEAKKVAWIQCVGSRDRSIGCSYCSSVCCTYAIKEAMIAKEHGEMDATIFFMDMRTYGKGFEAYYNRAQEE
    TGIRFIRSRSFELGPGSSEHTVKIRYSDEGGEIKHEEFDIVVLSVGLRPSSKAMETAKRIGVDLNQHGFAATTTSAPVET
    SRPGVFVCGTFHGPMDIPTAVMQASAAASGAGTLLAEARGTLVKSEEPVAEMDVSGQEPRIGVFVCHCGINIGSTVDVPS
    VVEYIKNAPNVVYAEENLYSCSSDTQDKIKEIILEHKLNRVVVASCTPRTHEPLFRATCASAGLNPFLFEMGNIREHCSW
    VHMKDKEAATAKAKEIVNRAVAKARLLEPLQTVTIGVNKDALVIGGGIAGMNAALDLANQGFKVSLVEKSDQLGGMARRI
    HVNLEGMDVGAYLDGLIGAVNANPNITVYTGAKITDVSGYVGNFITTIDVGGQPKDIEHGAVIIAIGGKELKPSEYLYGQ
    DDRVLTGLELEAELVKGTDRAKRAKNFVMINCVGSREPDRVYCSRICCSESVKNALKAKALNPDASVYVLYRDMRTYSFK
    EDYYEEARRKGVIFLRYDPAGKPVVSNAGGNLTVTVTDPILGETFVIDADLVGLAAATLPPDDSRDIGQLYKVCGDYDGG
    FFLEAHMKLRPVDFATDGVFVAGLAHGPKFIEESIAQARAAAARAATVLTKDLLVGGGAVAKVDKDKCSGCRICVTVCPY
    SAISFLEAQNVAEVNEVLCKGCGTCAAACPSHAAEHQGFKDEQLFAEIEAFLV

    >gi|169830381|ref|YP_001716363.1| DsrE family protein [Candidatus Desulforudis audaxviator MP104C]
    MWRNIGIVVQTADAEQAWSAFRLANRALDEGHEVRVFLLSQGVLAGDLGEEPCNVNKQMRIFIANDGQLWACGKCLALHE
    KEAGELCPFGGLKDLLELVEWADKLLTF

    >gi|169830491|ref|YP_001716473.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Candidatus Desulforudis audaxviator MP104C]
    MAEDRILIIGGVAAGPKVAARARRLLPDAEITVVDKGRYISYAGCGMPFYIDDQVGHFRELFSTGYGLPRDAEYFRNERG
    LNFLTRTEATAIDRVRKEVRLRNLETGQEETLGYDRLVLATGAESVMPRIEGTDLAGVFKFRDPGDAQAVKEYLETRNVQ
    EAVVVGAGFIGIELAGALANLKLLTTVIEFQERILPLTFDSDMARLLEERLAAAHGIEFRTGERVIRLEGDDQGRVRRVH
    TDRGAYDAELVIVAVGVRPNVKLAREAGLAIGRTGAIAIDQHCRTSDPDIYACGDCVETTHRLTGEKVYSPFASAANRQG
    RVVADNLAGRPSIYRGVLGTAVLQAGSFNAGRTGLTEEQARKLGRQVVAGLAPQRDRTHYHPGSGMVILKVVADGESGRL
    LGVQGIGPGEVVKRIDVAAAVLHFGGTVNDLTELDLGYAPPFNTPVDPLQHTANALINKLEGIVETIGADELKAKLDANE
    DFVLLDVRLEKEAKYRKIDDPRRMLVTLSELRQRVEEVPRNKEIITI
    CDIGVRSYEAYRLLRGAGFTKVRSVEGGMRTWP
    YGPASMF

    >gi|169830733|ref|YP_001716715.1| glutaredoxin [Candidatus Desulforudis audaxviator MP104C]
    MGRTIVYTKTGCPFCAGLIREYREQGLEFEEINVSLDPEAKKLVKGTYRVNRVPVVVRDGQVVQVGDRAGKG

    >gi|169830750|ref|YP_001716732.1| thioredoxin reductase [Candidatus Desulforudis audaxviator MP104C]
    MKDLVIIGGGPGGLTCGIYAVRSGLDVVLYERSALGGSVLSAEKVENYPGFPGGISGPDLIARMEEHALQIGLPIEFTEV
    HEITPDNSHYRLRTRDGEVSTRVVVIATGTGPRPLGVQGEDRLRGRGVSY
    CAVCDGAFFRDQPVAVVGGGDAAVEEAHYL
    SRFASRVYLVHPRESIKRSRVGQRRIEENRKIETVPNTRVLAISGDRAVDGIVLENIQTGEKWNLKVDGVFVYVGIQPNS
    YLVEKLVDLDNRRFIITDSHMRTSRPGIYAVGDVRRTPLRQIATAVGDGAIAAIWAEKYITSLS

    >gi|169830756|ref|YP_001716738.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Candidatus Desulforudis audaxviator MP104C]
    MPRTGVFVCWCGSNIGGVVDCPGIAAEAARLPGVVYSADEKYMCSEPGQNKIIQAVREHRLNRVVVASCSPRLHEETFRK
    VLARAGLNPYLVEMANIREHCTWVHGPEPERAQVKALSLVRRAVAKANCLQPLSGSRIPVTRRCLVIGGGIAGLQVALDV
    ADAGHEVILVEREPTLGGNMAKLDKTFPTLDCSA
    CISTPKMVSAVSHPNIRLYTYAEVEKLTGYIGNFEATIRQKARYVD
    HAKCSGCGTCWEKCPVRVPSEFNAGMSDRKAIYIPFPQAVPNKPVIDRENCRYFKTGKCRICQKLCPAGAVEYEQEEETA
    VEKVGAVVAATGFKLFDWARVYGEYGYGRYPDVITGLQFERLVNAAGPTGGKIRRPSDGAVPQTVVFVKCVGSRDEAKGR
    AYCSRICCMYTAKHALQVLEKVAGARVFVFFMDVRTAGKGYEEFYQRAVREGAVYIRGRVSKIYQDGGRLVVKGADTLLG
    RPVEVDADLVVLATAVEPAAGAAAVARLLGINADQDGFFQEAHPKLRPVETHTGGVFLAGTCQAPKDIPDTVAQAGGAAA
    KVAGLLSRDELVTSPMVSTVNETLCSGCLLCVPVCPYRALEAGVITERISGYPARERTVVKVNTGLCQGCGACNAACRSG
    AIEVRGFTNEQILAELEALCL

    >gi|169830960|ref|YP_001716942.1| methyl-viologen-reducing hydrogenase, delta subunit [Candidatus Desulforudis audaxviator MP104C]
    MANQPKIGIYLYPGQEPDALDWKTLAGALRVHPARPIIREMQGHALGAGLKELRVQLREDVVNRVIVAASCSVGLIEPTL
    HKALRAEGVDPNLAQVVDLSLCTGGGAEAATKRARILLEMALAKAVRLEPKVTAAVTGYDTVLVVGGGIAGLTAAHELAA
    AGYRVVIVERRPFLGGKVVQLHRYYPHSCDPV
    CGVSYLLETLRENDRVTIETAAEVAGVTGFPGRFEALVRRSGTESRDV
    VYTVGAVIIATGWEGFDAGQIKEFGYGKYPNVVTAMDLERLASPSGPTGGRLVRPSDERPVKRVAFIQCAGSRSERYLSY
    CSQICCTVTIKQLSYIREAYPEAEITVFYIDLRVLGKYEDLYRQALADGVRFVRGMPARIEENSKTRDLVVRAADSLSGR
    QLAQTVDLVVLATGMVPNRQLEWLSGFEAPDLTHNTHEQCFPGITARPGVYLAGACEEPMDVTQSVRSSLSAAMRCVKFL
    REKLDVAGLVPMVDDTKCDRCGRCVSECPTGAMRFITEGKPPVPDPLSCRHCGICQGGCPLQCVALPSYCFQGVADMIQA
    VEFDLLTKDDPAILLFLCRHDAYPAYEAACAAGTVPPNVIPVRVPCAGTVNAAWVADALMHGFDGIAVAG
    CPREECHAGT
    GFSLAKERLASAGETLYRMMIEPERVAALPVGIRDAAQLAAKLWAFSAQLKGMGANPLRV

    >gi|169831040|ref|YP_001717022.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Candidatus Desulforudis audaxviator MP104C]
    MAVHKVGAVMVVGGGVAGIQAALDLADGGFKVYLVDEAPALGGKVPQLSRTFPTNECSLCSFSPQLARITRHPNLEVLVG
    TRVEGVTGDPGRFRVSLRHSPRGVAAEACKGCGDCAAVCPVEVPDAFNMGFGTRKAIYQPYSQAYPRAYVLDPEHCIECT
    LCVEACPTGAVTLGAPEEASQVEVGAVILCPGCEVFDPSPLKNLGYGLLPDVVTNLELERLLSAAGPFGGRLARPSDGAP
    PRSIAWIQCVGSRNRTLGREYCSTVCCMAALKGAVTALEQAEGPLDTVVFYQEMRTPGKGFDRYRQRAERKGVELRCAGV
    DTVRPCDGGLEVRYAGVDGPGWQVFDMVVLSAGIGPGPGAAALARRLGVDLDRYGFCPPAAPGGTTTSRPGLFVAGTFAG
    PKDIAAAVIEAGAAAAEAGALLAGARGAAGREEQPVPERDVREERPRVGVVVCRCGTNISGAVDVSAVVEAAGRLEGVAL
    TLEMIHACAPDSLDRLVKTVREHGLNRLVVAACSPRSHRSLFQNVLRDAGVNGALCEMANIREHCAWVHRKPEAATAKAC
    RLVSMAVAKALLLEPVPYVTVPVLPAALVVGAGPSGLSAALGLAEQGFEVHLVDKKEAPGGAYRGVAEERRPGTGPVRSL
    AEQVVRHPLVRFYPENEPAAVEGHIGRFVTRLRGGQVIHHGAVVLATGAREARPDSHLYGEHAAVITLSEAERESPGAGA
    GDTTVFIQCVGSRDARRPWCSRACCRRSLALALEMKTAHPQRDIYVLFRDITVSGSDERLYSEARARGIIFVRYRPGEEP
    RVTAAGGRVAVEVADPVLGCNLRIDADRVILAAATEASADSRALAHLFKVPTDQDGFFLQAHTTLRPVDFSAAGVFMCGD
    AAGPKNLFESLLEGRAVAARCAAILGRGSVTAPGVYARVTPEKCAACLGCVRVCPFNVPVIAGNISWIEPVQCQGCGICV
    AECPNAAIHLIGYRKEQLLSQVRAGLAGGSGEVGA

    >gi|169831084|ref|YP_001717066.1| thioredoxin [Candidatus Desulforudis audaxviator MP104C]
    MIVEINEKTFENEVTRSDQPVVVDFWAEWCGPCRSMAPVIQQVAAEFAGRVKVGKVNVDQNQALTARFGIKGIPTLLFFR
    DGQVVDQEVGFTPRGVVVEKINALLKK

    >gi|169831300|ref|YP_001717282.1| thioredoxin-disulfide reductase [Candidatus Desulforudis audaxviator MP104C]
    MTEPEMYDVAVIGCGPAGLSAALNAAVRRKKVVLFGGEFCVSKINRSPRVDNFLGRPGVTGEALHREFVAHVRKFNIPMV
    NKRVINVFPEAEGFGLAIKDRVYRARTVILTVGMAVARMLEGEEGLVGRGVSY
    CATCDGPLFRGKTVAIIDYTKEGIEEA
    TYMAGFCSWIYYVCMHTEPPQFEQDNIELLKGLKPVRILGADGTVKALELDKRIVAVEGVFIFREAFPPQDLVPGLELEG
    NHIKVSRALETNIPGIFAAGDCTGKPYQLAKSVGEGQVAALNAVAYLDSAGSK

    >gi|169831685|ref|YP_001717667.1| methylated-DNA--protein-cysteine methyltransferase [Candidatus Desulforudis audaxviator MP104C]
    MPAVVVRLQAGWIGFARTESGLRALTFPQAGAEAARAQLASLGVTGEEAVLSPEPLDRLLTDRLETYFSGRAVDFDLIPV
    DWSGYTPFQRAVLEAVREVPWGETRTYGELARLVGRPRASRAVGNALGTNRTPLVVP
    CHRIIRAGGALGGFGGGPELKDR
    LLRLEGGDSALHGTE

    >gi|169831772|ref|YP_001717754.1| redox-active disulfide protein 2 [Candidatus Desulforudis audaxviator MP104C]
    MFFKKKDEPGKAEATQVNIGGVRVGIIGIDDALEAVKKLDLKTDREIGNALVELLRPNNYIPEAALDEYRADLARYYRIR
    MGLPVEKRAPVPGLLEIKVLGPG
    CSRCKQVFELVRDVVAEEGIAADLEYVDDIAEFANYGVLITPALLINGEVKLAGKAP
    TRNQLVAWLKEANS

    >gi|169832022|ref|YP_001718004.1| heavy metal translocating P-type ATPase [Candidatus Desulforudis audaxviator MP104C]
    MTEELRGVAVPGEGGAAATRRLDLRVEGISCASCVRRVEQVLAGVPGVLEATVNFATGKATVTYEPDRVKVPELVAAVSA
    AGYRAAPAESTRVILPVRGMT
    CASCVRRLEEALSRTGGVHHAAVNLATEKATVDYDPGVVSVRALEQAVRDAGYQVEALA
    AQAGEDRERAARERSMRRLTWDFAVGAFFTTVVLIGSLPHMYPPWAGFAPHILTTPLVLLFLTAPVQFGSGWRFYAGAYA
    ALRHGAADMNVLVALGTTTAWTYSAAMTLFPDFLTGLGFPYQLYYDVATVITTLIVLGRLLEARARGKTSEAIRKLMGLQ
    AKTARVIRDGREVDIAVADVEVGDLILVRPGERVPVDGVIVSGRSTLDESMLTGESLPVERSAGDKVVGATINKTGTFTF
    EATRVGRDTVLAQIIRLVEEAQGSKAPIQRLVDVVAAYFVPAVVGTAVLSFVLWFLFGPPPTFIFALTTFIAVLIIACPC
    ALGLATPTAIQVGTGVGAENGILFKGTESLETAHRVQAVVFDKTGTLTEGKPALTDVVLREGFGEEEFLRWVASVESRSE
    HPLGEAVVAGARERGLVLVEPEEFEAVPGRGVQARVDGRALLVGNRLFMDERQVAVGDLEEDVQRLSNEGKTPVFVAVDG
    LAAGVLAVADTLKEHSAEAVRELRRLGLEVIMMTGDNRRTAEAVARKAGIQRVLAEVLPEHKAREVKRLQEEGKIVAMVG
    DGLNDAPALAQANVGIAIGTGTDVAMEASDVTLITGDLRGVVKAIQLSKATIGMIKQNLFWAFAYNIVLIPVAAGVFYPF
    YGILLNPMLAAAAMAFSSISVVLNSLRLRWFKPAPA

    >gi|169832027|ref|YP_001718009.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Candidatus Desulforudis audaxviator MP104C]
    MANKSILVVGGGISGLTTALEAAEVGYEVYLVEKNPYLGGRVAQLHQYFPKLCPPNCGLEINFRRLRKNPRIKFFTCAEV
    EKISGRKGDFDVTVKLSPRYIKPECTACGDCVAVCPAERPNDFNYGLDTTKAIYLPHPFAFPLKYLIDRQACPDGCAKCV
    EACKYNVIDLTMAPETVNLKVGAVVYATGWKPYDAAKISYYGFGRLKNVITNVMLERLAVPNGPTEGRIVRPSDGKQPET
    IAFVQCAGSRDENHQAYCSQICCLATLKQITYIREKNPDAKIYVFYIDIRALGKYEDFYTKVAKDENVVFIKGKVGEITA
    DPATGDLTLETEDQEAGKTVTQKVNLVVLATGMAPSTLEAPVPSELAAADAGGFVVSDIAETGIGGAGCARKPMEVSASV
    RDATAAALKAIQATVGGGK

    >gi|169832126|ref|YP_001718108.1| methyltransferase type 11 [Candidatus Desulforudis audaxviator MP104C]
    MNEDLKCACVDFYQNDVVRLLLGRSFHPGGLELTRRLGEALALGPGDFLLDAACGTGTSAVFLAGVFGCRVLGVDLGAEN
    LEQARRHAADAGLTDRVEFRQGDAERLPLEDGACTAVISECSFCLFPDKETAAREMFRVLAAGGRVGLTDMVVDRDRLPE
    EMKGLLFRAA
    CIADALTVDGYRAVLAHAGFTGLTATDHPEALLALAGQIRQRLLLAELAQAVGKLDLKGLDLKRGKVLLH
    QAEELVRDGVLGYTLITGSKP

    >gi|169830328|ref|YP_001716310.1| molybdopterin oxidoreductase [Candidatus Desulforudis audaxviator MP104C]
    MEMEAVEFTINGLPVRVPGKGATILEAALRNGIYIPHLCHHPDLKPAGLCRVCMVEADGKMVAACRTPVADGMKVATGSP
    NLDQYRRYIVGVILAEHESDCLT
    CGKNLNCKLQEVARYANLEPTKFKELRPVKPGKPLDDTHPWIVRNHNKCILCGICVR
    TCREIAQVNAIDFAFRGRATTISTFGNKPLHESNCVSCGECVARCPVGALLPKVSAEPAREAALIPPQVVRECERRPETP
    PSLFMLKEKGAVAEKITLTIDGLEASVEKGATVLEAAQKAGIYIPFLCFHPELTGSGGCRVCAVEIDGKVVPSCTTRARE
    GMVVRTSSPQAREAQAAAVKRILAGHNGDCLNCAKNGRCKLQEVVGYTGVYQEMAGTPAPFAEVDESNPYFVLDRSRCVA
    CGICLRTCRQVNGADALEFKRVDNHRVVVPRQGGSLAESACESCGECVARCPVGALLPKELQQPGREVETVCTECGIGCG
    VYFGARGGRLVSARQNLSHKTSKGRLCGKGRFGWGVLNHPDRLKTPLIKKDGQFVEAGWEEALGLAAGGFSRYKGGGAVV
    LYSPRVTNEEIYLALKFARAVLGTSNIADAESFASRAGLLDGLGTTVGSNAMTIPVRQIERAAGHFVISSSPTESHPIIG
    FEIRKSVNKGAKLIIADSREIPLSRLPHIRLALRPSTELALLLGMARAILDEKLHDEGFIRERTTNFDAFQKSLADFTVE
    KAAEITGVPGAQIREAARVYATSKPALLFWSEEIAQHPTGQDSVRVLAQLALMTGNYGKPGAGFVPLIGRSNFQGALDLD
    VTHPWSLVSKEKVADAWGCAVPEPAGSAENKAKAWYIIGADPVTKAADADSVRKALSEAPFVVVQDTFLTETAKLAQVVL
    PTAGFAEKEGTFTAVDRLVQRVRQVAEPPGAAKPDWWIICEIAHRMEAEGFAYNHPSQIMEEISSNYPAYAGISYDRLDP
    EGLRWPCPDKEHPGTDVLHESEFFGLGKAQFRPLQYKP