Candidatus Azobacteroides pseudotrichonymphae genomovar CFP2 uid59163

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212550597|ref|YP_002308914.1| heterodisulfide reductase subunit A [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
    MSKIGVFVCHCGENIASTVDCEKVATLAAQLPSVVFSIDYKYMCSDPGQNKIKEAIKKHNLTGIVVSACSPRMHESTFRK
    ACFEAGLNPYLCEIANIREHCSWVHEQEENTTQKSFHLIRGLVEKVKSNHPLQPIKIPVNKTAIVIGGGIAGIQASLDIA
    NGGYQVVLVEREPSIGGHMAQLSETFPTLDCSQ
    CILTPRMVEVAQHSNIALYTYSEIENIDGFIGNFNVKIRKKAKSVNE
    KICTGCGICCIKCPSKKNPSKFEQGLSYRTAIYIPFPQAVPNKPIIDRNDCRFFQTGRCKVCQKFCPTGAIDFEQKDEII
    EIKAGAIVIATGFEIKKTDFFPEYGYGKYKDIIDGMQFERLASASGPTKGEIRRPSDGKIPKKIVFVTCAGSRDPAKGIP
    YCSKICCMYTAKHAMLYKHKVHEGMSYIFYMDIRAAGKNYDEFTRRVIEKEEAKYIRGRVSSIYEKNEKLIVKGADTLLN
    GKPVEIEVDMVVLATAVISCNDSEALAQKLHISYDSYKFFAEAHPKLKPVETNTAGIFLAGSCQAPKDIPESVAAASAAA
    AKVLCLFFNNELIREPIVAKINRVPPPLYSTCMGCELCIKICPYQAIDKERIKNHNGQVIKTVVHINPGLCQGCGTCVAF
    CKSKSIDLEGYSNKQIYEEVLALLNEY

    >gi|212550631|ref|YP_002308948.1| molybdopterin biosynthesis protein MoeB [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
    MNFTSEQIERYSRHILLQDVGLEGQEKIGDSKVLVIGVGGLGAPVLFYLAAAGIGTLGIIDREVVDLSNLQRQIIHFASD
    VGKIKVQSAKEKIKQINPSVKVVTYQESFNVNNAFDVIKDYDFIVDGTDNFPTKFLINDACVLAGKPFSHGGILQFEGQT
    LTYLPGTMCYRCVFHSPPPSNSIPT
    CSQAGVLGTIAGILGTIQATEVLKFLIGTGELLTNRLLTFNAKSMIFRTIKINKN
    RECLICGSYPSITNLAESERIVCELENK

    >gi|212550707|ref|YP_002309024.1| thioredoxin [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
    MAIQITDNNFNELLASTKPLIVDFWAEWCAPCRMIAPIIEELASEYKERVIIGKVNVDQNEELSSKYNIRSIPTLLFFKN
    GELVDKQIGGTSKNDIEVKIKTLL

    >gi|212550796|ref|YP_002309113.1| NADP-dependent thioredoxin reductase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
    MKHNTNNKSSLQDEEQVKCLIIGSGPAGYSSAIYTARASLSPILYEGTQSGGQLTTTFEIENFPGYPDAITGIKMMENFK
    KQAQKFGTDVRKGTVTACDLSRQPYKVVIDNKQTIETDTLVICTGATAKYLGLSDEQKYIGRGVSA
    CAVCDGFFYRKKIV
    AIVGGGDSACEEALYLASIANKVYLIVRKNHLRASQIMQTRVLSNTKIEVYFNTNVIGLFGEEFVEGIHLIKYRGEANEE
    KIDMTIDGFFLAIGRKPNSEIFRTYISTDSNGYIKTQHGTTKTNLPGVFAAGDVSDPNYQQAITAAGAGCMAAIEVERYL
    NEMKH

    >gi|212550979|ref|YP_002309296.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
    METIYRYLSPIGCLEIKAEEKILTRLYLCKKNALSDNFISNHPIIQQTCIQLNEYFAKKRQSFELPLDIIKGTVFQKKVW
    EELQLIPYGKTISYLQLAQAIHCPNAYRAAGTATSKNPIIIIIP
    CHRVINTNGRLGGYTYGVKIKKQLLDLEQ