Candidatus Amoebophilus asiaticus 5a2 uid58963

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189501484|ref|YP_001957201.1| thioredoxin reductase [Candidatus Amoebophilus asiaticus 5a2]
    MDNASTSSPVSVAIIGSGPAGYTAAIYAARAGLDVVLYQGLQPGGQLTTTTEVENFPGYPEGALGSQMMVDFQTQAQRFG
    TDIRNATVTAVNFSCYPFQLTIDTTTTVEAKTVIIATGASAKWLGLESEKRLNGRGVSA
    CATCDGFFFRGQDVAVVGGGD
    TAAEEALHLSKICNKVYVLVRSDKMRASHIMQQRLISKPNVSIFFNTGIEEILGDQEVEGVRLFDKRSQTSFELLLQGFF
    VAIGHQPNTALFAPYITLDNKGYIQTTPGSTKTNIPGVFAAGDVQDSIYRQAITAAGTGCMAALDAERFLATEGQ

    >gi|189501532|ref|YP_001957249.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Candidatus Amoebophilus asiaticus 5a2]
    MAMIGKKAPVFRAPAVINGTEIVQDFSLAQYLGKKEVIFFFYPKDFTFVCPTELIAFQNALGEFEQKGVAIVGCSTDTEE
    THIAWLNTPRNQGGIMGVTYPIVADIAKTISANYGVLGGEWEYDEEGGFSFSGLPVAYRGTFFIDKQGIIRHESINELSL
    GRNIAELLRIADMWHHVEQFGEVCPVNWTQGQESMQATREGVSSYLTKNMDNK

    >gi|189501736|ref|YP_001957453.1| hypothetical protein Aasi_0286 [Candidatus Amoebophilus asiaticus 5a2]
    MRLITDNQAKIFCQALVDKNSLYERIFFVGIETTGVFFRSICYARKPKFENCIFFNTVQDALLASFRPCMRCCPLIHPGQ
    VSPLVQTLVELIEINPEKRWKNSDFKELSVDASTVRRQFKRRFGMTFIQFARVKRMGIAMKQIQKGESVIAAQLDSGYES
    SSGFRDAFAKIIGAGPTKFDEHHTVLKSSWIDTPLGPMLAITDEEFLYLLEFVDQHNLERKLERLRSNLRAVIVPGRTQL
    TQQIESELNKYFEGSLKEFKIPIYLLGSSFQQLVWSKLMTIPYGQTRSYGEQAKALGKETAYRAVASANGTNKIAIVIP
    C
    HRIINNNGKLGGYSGGIHRKKWLIDHERQHQQ

    >gi|189501860|ref|YP_001957577.1| hypothetical protein Aasi_0435 [Candidatus Amoebophilus asiaticus 5a2]
    MVENSCHSLNLVVPMHTSYDLIIIGGGPGGYVAAIRAAQLGMRVAVVEQEALGGVCLNWGCIPTKALLKSAQVFEYIKHA
    ASYGIQVQDATPNFTSMIQRSRGVANTMSKGIQTLFKKHKIDTIYGVGKLGTRTTVIVKDHTGNNTTYQAKNIILATGSR
    SKSLPNLPIDRQHIIGYREALSLPKQPKSMVIVGAGAIGVEFAYFYNAIGTSVTLVEYMPRILPLEDEDISKQLLKSLTQ
    TDISVHTSTEVIGVIRDGGQCQVQINSQTGMQTLPCDVVLSAVGVVSNLENIGLEEVGVSVEKGKVVVDDFYRTNVPGIY
    AIGDIVRGPALAHVASAEGILCVEKIAGLEPESLDYHNIPACTYCQPEVASVGYTEQAAKEAGYSIKVGKFPFTASGKAH
    AAGDSTGFVKVIFDAKYGEWLGAHMIGHNVTEMIAEVVAARKLETTGHEIIKSVHPHPTMSEAVMEAVAAAYQEAIHI

    >gi|189502057|ref|YP_001957774.1| hypothetical protein Aasi_0649 [Candidatus Amoebophilus asiaticus 5a2]
    MNKEKDIHLTDAEFDKALQSSNPVLVDFWAPWCGPCRMMSPIIDELAKEYEGKADIYKLNIDENSQVPTKYSIRSIPTMI
    IFKNGQAVERIVGGLSKIALEEKLDIYTS

    >gi|294661216|ref|YP_003573092.1| hypothetical protein Aasi_1657 [Candidatus Amoebophilus asiaticus 5a2]
    MPLPNRLSTTTSTYLLQHAHNPIDWYPWGEEALSRANQEDKPILLSIGYAACHWCHVMGIRVL

    >gi|189502296|ref|YP_001958013.1| hypothetical protein Aasi_0918 [Candidatus Amoebophilus asiaticus 5a2]
    MSEKPYHILLYYCYTTIENPEVFREEHHRFCADLGLLGRIIIAKEGLNGTVSGLQVACDEYMQHLKADPRFEAIQFKIDE
    HPHHAFQKLHVRVKSEIVHADLHHINPKQGSGQYITPHELEQIKDEEDVVLLDVRSNYEHKIGKFKNAVTLDINHFREFK
    YQISNLSAYKDKKVVTY
    CTGGIKCEKASAYLLEQGFKNVYQLHGGIIQYANETEGEAFEGKCYVFDNRLVKDINKKEPIV
    IGTCHICGANCDRMVNCANPLCNVHVPICTNCGETMEGACSKDCKQHPDKRSYNGTGYYTTKLNGYNPYKGLRKKETN

    >gi|189502370|ref|YP_001958087.1| hypothetical protein Aasi_1006 [Candidatus Amoebophilus asiaticus 5a2]
    MHLKVGDQAPTFIGKDQNGNTIQLSEFAGKKLVLYFYPKDNTPGCTAQACNLKDNYYALQQAGYEILGVSSDNEQSHQEF
    IDQYKLPFRLIADQDHTIHKQYGTWVQKSMFGKKYWGTARKTFLIDEHGKIEQIIEKVKTGEHTNQFFPKR