Candidatus Accumulibacter phosphatis clade IIA UW 1 uid59207

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257074469|ref|YP_003162867.1| heavy metal translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MDCPTEEALIRNKLGGLATVSGMEFNLMQRVLTVVHQNNTLAAVETAIRDLGMSTEPMEASSQGRAPTEAVSKPWWPLAL
    AGLAALGAEIVHWLGLPEWLSGLLALVAITISGVGTFKKGWIALRHGNLNINALMSIAVTGAVLLRQWPEAAMVMVLFTV
    AELIEAKSLDRARNAIRSLVQLAPEMATVQQADGDWAELPAKAVAIGQIVRVKPGERVALDGVVTAGRSSINQAPITGES
    LPVDKSAGDSVFAGTINQSGSVEFRVTAESTHSTLARIIHAVEEAQGARAPTQRFVDQFAKIYTPAVFVFAIAVALVPPL
    LLGGSWQDWVYQALVLLVIACPCALVISTPITIVSGLAAAARHGILIKGGVYLEEGHKLAWLAFDKTGTITHGKPVLTDT
    VLLDQTDGVDAVRVATSLAARSDHPVSHAIATSGQRNDTVLLDVADFAAIPGRGVLGTVGGVQYQLGNHRLIHELGVCTP
    PLEARLGELEEQGKTVILLTDGERVLVLFAVADTVKDSSRAAIRALHELGIKTVMLTGDNAHTARAIAAQVQIDEALGDQ
    LPEDKLRAIERYAQTGKVGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDDLNKIARFVRLSRTTRTVLVQ
    NITLALGIKVVFLALTLLGMGTMWMAVFADMGASLLVVANALRLVRR

    >gi|257074489|ref|YP_003162887.1| heavy metal translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEEALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLF
    PVEQALTAIGMQAVRMDQASTGQTTKLSITKMD
    CPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQ
    ALGFEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVAVFTGGLSTYKKGWIALKN
    RNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAI
    GSRVRVKPGERIALDGEVLEGRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FSALPGRGVQGQINGETYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRSAIAEL
    HALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDNLGKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLR
    K

    >gi|257074517|ref|YP_003162914.1| heavy metal translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEEALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLF
    PVEQALTAIGMQAVRMDQASTGQTTKLSITKMD
    CPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQ
    ALGFEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVAVFTGGLSTYKKGWIALKN
    RNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAI
    GSRVRVKPGERIALDGEVLEGRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FSALPGRGVQGQINGETYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRSAIAEL
    HALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDNLGKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLR
    K

    >gi|257091619|ref|YP_003165262.1| hypothetical protein CAP2UW1_4690 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSLDPNPKPLPETAHCGCAGGCSAAVTTAAEIPAASGLVQSDGVPVFLIPTMDCPNEENDIRRAVAGIDGIRSLRFQLSA
    RTVSIDATTESLDAALAAIRKAGFSPKAVSAEQAATKNAGVSELWRSVLALVLAIGAEAVDYFAPDTLPFKGFGMALAVV
    AIWLSGISTYSKGLAALRRGQLNMNALMGVAVTGAFLIGQWPEAAMVMALYAIAELIEARSVDRARNAIKGLLDLTPETA
    EVRQDDGTWLEVPAAEVKLEASVRVKPGARIPLDGQVTAGSSAVNQAPVTGESIPIDKAAGDPVFAGTINETGILEFRVT
    AAADNTTLARIIHAVEQAQGTQAPTQRFVDRFAAIYTPTVFAIAVAVAVLTPLLLGWSWTQALYKALVLLVIACPCALVI
    ATPVTVVSGLAAAARRGILIKGGVYLEEARKLRVIALDKTGTITEGKPRLVAMEILPSAVPESQVLAWAASLAGHSDHPV
    SKAIATGLKLPENGLTDFVALAGRGVEARTDGQLIVLGNHRLVEERNLCSAEIEARLQLHETQGRTVTMLASAQQVLAIF
    AVADTIKESSREAVADLHRLGVASAMLTGDNVATAASIAREAGIDDVRGNLLPEDKLAAIEDLQRRYGQTAMTGDGINDA
    PALARADIGVAMGAAGTDTAMEAADVVIMNDDLRRIPETIRLSRRTHAVLWQNIGLALGIKAIFLGLAVFGNATMWMAVF
    ADMGASLLVVANGLRLLRVTGPGKETAA

    >gi|257091645|ref|YP_003165288.1| hypothetical protein CAP2UW1_4718 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSECASTACGCSAGPIIQPTTQAPATTGSAQAVYRIENMDCPTEEALIRGKLVGLAGVVGLEFNLMQRTLAVRHELPSLF
    PVEQALTAIGMQAVRMDQASTGQTTKLSITKMD
    CPTEETLIRNKLGTMAGVADLDFNLMQRTLSVRHADQVLPDVLAALQ
    ALGFEAQVLDTAEAASPSASLVTTPTNWWPLGISFVTASAAEAVYWLHNGNHWSVVVLALVAVFTGGLSTYKKGWIALKN
    RNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDLTPEQATVQQADGTWREVGAKQIAI
    GSRVRVKPGERIALDGEVLEGRSAVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPIVFGVAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALAANSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FSALPGRGVQGQINGETYHLGNQRMLEALGQCTPELEQRIAALETMGKTVVMLVSAKGVHALFAVADTIKESSRSAIAEL
    HALGINTMMLTGDNPHTAQAIAAQAGIDSAQGNLLPDDKLREVELLAIKGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDNLGKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLR
    K

    >gi|257091923|ref|YP_003165564.1| Redoxin domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MASTVTLGGKPFQVGGILPEKGQTAPAFTLVGKDLANVSLSSFAGQRKVLNIFPSIDTPTCATSVRKFNEKASGLSNTVV
    LCVSADLPFAQARFCGAEGLERVVTLSTMRGREFLEAYGVALSDGPLAGLAARAVVVLDGDDKVLHSELVAEIKNEPDYD
    AALKSLA

    >gi|257091953|ref|YP_003165594.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MASHVIIGNGPAGVVAAETLRRVDPHSEITLIGDEAEPPYSRMAIPYLLMGRIGEEGTYLRKDAGHFEGLRIRLRQGRVT
    ALDTGARRLRLADGSGLAYDRLLIATGAHPVRPPIPGIDSPKVLT
    CWTLADARAIAATVNPGARVLQMGAGFIGCIIMES
    LAARGPRLTVVEMGDRMVPRMMDEVAGAMIRRWCEDKGVGVRTGRQVVAIAPAGEALRVTLDDGEAIEVDVLISATGVKP
    NIAFLAGSGVAVDAGILVDEAMQTNIAGVHAAGDVAEAVELGTGRRVVNAIQPDAVEQARIAALNMAGQAATLRGTFVFN
    VLDTLGLISVSFGQWQGVPGGETASLVDQADYRYLRLVFDGDRLVGANSIGHTEHIGVLRGLIQGRVRLGPWKDRLLANP
    LQLSEAYLARGLAALH

    >gi|257091962|ref|YP_003165603.1| Glutathione S-transferase domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MMNLYSGTTCPFSHRCRIVLYEKGMDFQVIDVDLFAKPEDIAIINPYGRVPVLVERDLILYEPNIINEYIDERFPHPQLM
    PADPIMRARARQLLITMEREVFAYIEPLERNSKTADKARQQIRDRLTEMAPVFVKQKHMLGEEFSMLDVAIAPLLWRLDH
    YGIELSRLAAPLMKYGERIFSRQGFIDALTPSEKAMRK

    >gi|257092092|ref|YP_003165733.1| protein of unknown function DUF255 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPDATPPGADPLAAELQARLAGAIALRGPAYVPRTHHLDADGRPLFINRLALETSPYLLQHAHNPVNWFPWGDEAFAEAR
    RLGRPVFLSIGYST
    CHWCHVMEAESFEDEAIARFLNRHYVAIKVDREERPDIDAVYMSAVQQLTGAGGWPMSVWLTAARE
    PFFGGTYFPPRDGGRDGQRGFLPLLGALSDTFHRDPERVGQACTALVEAIRHDMQGAYGTGGADAAIGLPAGDVIDATVA
    HYRQSFDARHGGLSRAPKFPSHIPVRLLLRYHQRTGDADALRMATLTLEKMAAGGLYDQLGGGFHRYSTDVRWLVPHFEK
    MLYDNALLVVAYAEAFQVTDRADFARVARETCDYILREMTDAGGGFYSATDADSEGEEGRFFVWREDEIRRELDALGDGD
    TTEHFLAHYDVHPGGNWEGHTILNVPRPDEAAWEALAAARARLYAVRARRTPPLRDEKILAGWNGLMISALAVAGRVLDA
    PRYVAAAVRAADFVLTHLRGADGGLRRSFKDGQARQAAFLDDHAFLAAGLIDLYEATFDVRHLRDALALAETTEHLFADP
    AGAWFMSSEAHESLIAREKPAYDGAEPSGTSVALLNALRLGVLTDDERWRQIAERGLRAHARVLGERPIAMTEALLAVDF
    LATTPRQIAVVWPDSAAAAAAPLLAVVGRHFLPARALAAAPESAVAALAQTIPFVGDKVAQGGRPTAYVCRHGRCKLPVS
    DAAGLEAQLREAGS

    >gi|257092240|ref|YP_003165881.1| Thioredoxin domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPVTAFLSDVEPSRAEIDALEEPAVIEFGTDWCGYCQGAQPMIGAALAQYPQVRHIRVEDGPGRRLGRSFRVKLWPTLIF
    LERGREVRRLVRPAAPGELDEALAQIAVAK

    >gi|257092356|ref|YP_003165997.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNRFLWPLIGFVVLVALLAVGLNLNPRDVPSPLVGKPAPDFALPQLAAPEQTFSPKDMLGKVWLLNVWASWCVSCRQEHP
    VLVELAKRQTVPLIGLNYKEVRGDGAIDIDKVAAGAEKPLVIERAAAWLAKHGNPYALSALDIDGRVGIDYGVYGVPETY
    VIDRAGIIRMKHTGPITPEVYSGKILPLLAELSK

    >gi|257092418|ref|YP_003166059.1| glutaredoxin-like protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MDAQQLIKEQVTGNPVVLYMKGTPEFPQCGFSAVTVQILKACGVSRFLSVNVLENPEIRSGIKEYANWPTIPQLYVRGEF
    IGGCDIMREMYEEGELQKLLEGLVESV

    >gi|257092419|ref|YP_003166060.1| alkylhydroperoxidase like protein, AhpD family [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSKSFTTITHDVSKALGTFRQDMPETLQGFNALAKAALAPGVLSALDKELIALAIGVSSRCDACVGFHVKALIRLGVSRA
    QLMETLAVCTYMGGGPSLMYAAEAVRAYEEFTAKATLANA

    >gi|257092448|ref|YP_003166089.1| glutaredoxin [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPAPVSLRVVCLVSLLLASATLGAQTTYRWIDPATGRTVLSDLPPPAGAKRVDRSSPSLGDEAPPTQALPYAVRQASEKF
    PVVLYTNPG
    CTTCKQARSLLDGRGVPFVEKELGTAEELADAGRQLGGEIRLPSISVGRQNVKGFTPTAWNELLDAAGYPA
    SAPYRVKPTGEAAQ

    >gi|257092607|ref|YP_003166248.1| DSBA oxidoreductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MFGRINGWCLALALSLLVFMTPARAQLVVGRDYVPIVPVQTTDNPGKLEVLEFFSYGCPHCSEFHPVVGKWSAALPADVV
    FKRVPVSFGRPAWASLARLYYALEVTGDLARLDGAVFNALHQAGGKLYDDKSIIEWVATQGVDARKFTDAFNSFGVISKV
    KRADQMAQAYKIQGVPALAVDGKYLVTGKETKGFTELIALTDQVINKARSERGKK

    >gi|257092612|ref|YP_003166253.1| periplasmic binding protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MQWSDALGKPHDRYPGSPRIVSLVPSITELVIDLGLAGVLVGRTGFCVHPRQAVRRIAKVGGTKGFSIDTLRALAPTHVI
    ANIDENRREEVEALRDFVPHLIVTHPLAPRDNLDLYRLVGGVFGRESQAADL
    CAAFEREWAATTAWLTGVPRQRVLYLIW
    RQPWLSVARDTYISRMLAAAGWDTLPVLSSVRYPEVDLPSVAREADIVLLSSEPYPFREKHRRQLLDELPGVRAALIDGE
    LVSWYGTRALHGLPYLRRLRRELANSPAT

    >gi|257092744|ref|YP_003166385.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MEAKSGSARNKVVIVGGVAGGASCAARLRRLDENTEILMVERGPYVSYANCGLPYHVGGVIEKESSLLVATADTFRRQFN
    VDVRTNCEAIRVSPDTKTIDLRNLETGEVTSEPYDKLVLSPGASSVRPPLPGIDLPGIFQVRTVPDARAIRDWIERGSLF
    LSGMDKYSGFQTLRPKTRAVVIGGGFIGLETAENLVHRGFEVTLVEMLDQVLAPLDQDMARIVESYVERHGIRLALNDGV
    AGFQQAANGSLEVLTKSGKVHPADIVILALGVRPETALAKTAGVAIGERGGIRVDEQMRTSNPDIFAVGDAIEVRDFVTG
    EWSLIALAGPANRQGRIAADVIAGRQSRFRGTQGTSIIGLFGAAAAWVGASEKTLKRLGDSDYEKIYLYPNSHAGYYPGA
    RPIAMKVLFRKSDGRFLGAQALGEDGVDKRISALAMALQMGATIHDLEEAELCYAPQFGSAKDPVNFAGMVAADILCGDM
    PLTHWDAADNAFLLDVREPGELAVESVPGVLNIPLGQLRARLDELPRDREILVI
    CRSGQRAYYATRALVQHGFTARTLAG
    GMLSRFHTRLLAN

    >gi|257092929|ref|YP_003166570.1| protein of unknown function UPF0061 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLNFDNRFLRDLPGDTDRHNAPRQVFGACWSPVDPTPVAAPTLLAHSREVAAALGLDEQAMAAPEMLAALAGNALLPGMA
    AYASCYGGHQFGQWAGQLGDGRAILLGEAVNRQGQRLELQLKGAGPTPYSRRADGRAVLRSSIREFLCSEAMHHLGVPTT
    RALSLVATGETVVRDMFYDGHPVAEPGAVVCRVAPSFTRFGHFELLAARGERELLQRLVDFTIARDFAELVTGAEPSLAA
    WFGEVCERTARLMVHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDNFDPGWTPNTTDASSRRYCFARQPAIARWNLER
    LADALAMLTPRPVELAAGIERYDEVYSSEFCAAFAGKLGLCEWHHDDADLLEELFELMRQAEIDMTEFFRCLASLDIDNP
    AIDVVQSAFYRDDLRLRFSAPVSRWLTRYAARVRQDAQPAARRAARMNAANPRYVLRNYLAQQAIDRAEQGDTQRIHDLL
    DVLRHPYVEQAGCAAFSAKRPDWARHRAG
    CSTLSCSS

    >gi|257093088|ref|YP_003166729.1| methylated-DNA/protein-cysteine methyltransferase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSTIWRQHATPLGPMVLAAAPEGLLGAWFVDQAYFAGVAAGWYEEAANSLLSEAAAQLDAWFAGRQCRFDLPLAPRGTPF
    QRAVWEQIAGIGHGQTRAYGTVAAALGKSGAARAVGAATGRNPLSIIVP
    CHRLLGHRGALAGYAGGLHRKRALLAFEAGN
    APLALAG

    >gi|257093104|ref|YP_003166745.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNDGQLLRYSRHILLDEVGIEGQERLGQARVLIVGAGGLGSPAALYLASAGVGRITLADGDTVDLTNLQRQILHTLERVG
    QPKAVSGQTALRGINPEVTVAAITTRLAGDALAAQVAEADVVLDCCDNFATRHAVNRACVRHHTPLVSGAAIRFAGQLAV
    FDSRRDHTPCYNCLFPEGDDVEEVR
    CAVMGVFAPLTGIIGAMQAAEALKLIIGVGEVAVGRLWLLDGLSMEWRSVRFGRD
    PECPVCACDSLS

    >gi|257093109|ref|YP_003166750.1| Rhodanese domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MVAPRPREPSGARQVSANLVSWPRWFVELRLEFIQQNLLLVAVAVVSGTMLLTLSVRRPGGAKSLTATQATMLINRENAQ
    LIDVREPNEYVNGHVADSRNIPVGSLAERAGELEPLKDKPVILV
    CQSGARSSEACATLGKLGFSRVHTLEGGVVGWAEAG
    LPLKKGARR

    >gi|257093110|ref|YP_003166751.1| glutaredoxin 3 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSVEPRVLMYSTAVCPFCVRAEQLLRARGVAAIEKVRIDLDPQRRLEMVEKTARRTVPQIFIGEAHIGGCDELMALDRAG
    KLLPLLAGEST

    >gi|257093149|ref|YP_003166790.1| glutaredoxin 2 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSQSPILTLVSRSYCHLCQEMEVALRPLLAEFDIDLEVLDVDADPTLEALYDELVPVLLHDGEELCHYFLDDRKVRDYLG
    EIR

    >gi|257093196|ref|YP_003166837.1| pyridine nucleotide-disulfide oxidoreductase family protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MQDAGQVVLRDIVLVGGGHSHVGVIKRFGMRPLPGVRLTVICTDTDTPYSGMLPGYVAGHYAYDEVHIDLRRLAEFAGAR
    FYRDEVIGLDRDQRQVLCRDRPPVPYDRLSINIGSMPAVGLVEGASEYAVPVKPIRRFNERWLALLERVCRHAGRTTIAV
    VGAGAGGVELTLAMQYRLRGELQRRGRDPDALAFHLFAAERDILATHNARVRRSFERVLTERGVVVHRAAEVSRVSAGRL
    CTRDGETLAADEVVWVTQAGAATWLRQTGLALDAAGFIEVRATLQTVSDPLIFAAGDCAAMLGRPLEKAGVFAVRQGPVL
    AENLRRSLLERPLRVWRPQRRWLALISTGGRYAVASRAGMHAEGAWVWRWKDWLDRRFMARFGDLLPMADQARSQRAPVP
    LDENEALQATSALAMRCGG
    CGAKLGGTLLSRVLAALHPIERADVLIGLRAPDDAAIVRVPPGKALVHTVDFFRSFIDDPW
    LFGRIAANHALGDIFAMGAEAQTATAIVTVPPGLERKIEDNLLQMLSGAIAVLDDVGCALVGGHSGEGSDLALGFAINGL
    IDENLAGVLRKGGMRPDDVLVLTKAIGVGTLFAAHARLRARGRWIDQALAVMAQSNAPGARCLREHGATACTDVTGFGLL
    GHLVEMVGSSRVSVEIALDDLPVLDGAVETSAAGIVSSLHVANLRARRYLRNPEQGSGHPHYPLLFDPQTAGGLLASIPL
    ARADACLRALRALGYDKAARIGRVLPADEHAEPICLLAQARAKPSG

    >gi|257093250|ref|YP_003166891.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSTRMATIGLVLAILAGTASAQAPGAAAPAFTINDTAGKPVALADFKGKYVVLEWTNPECPFVQKHYVSKNMQGLQKEWS
    ERGVVWLSINSTNANHSEFKTGPEVANWMRAQGSAQKATLLDSSSATGRAYAAKTTPQMFVIDPAGTVIYNGAIDDKRST
    NPADVKGASNYVRAALSEALAGKPVTVASTSPYGCSVKY

    >gi|257093251|ref|YP_003166892.1| putative ThiO:disulfide interchange protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLSFSARHTDSFVERTWRRLTESLVIVVALAWAAVAAAAPVHTPHVEAELLAERTALVPGEPLTVALRLRMAPGWHVYWQ
    NPGDSGVPTTIAWDLPAGIAAGPIQWPAPRALPAGPLINYGYEGEVLHLVELAVPASLAAVGTQTLRARVDWLVCKEACI
    PESVELGLTLPAAASAEANPASATTIAATRRALPRALAGWQASAAGQGTSITLRLAPPTGAGDPGTLRFFPFAERQIEAS
    APQTLARAGNTYLLTLPVASDLAGPLPRLNGVLTASGTLGEAVTAATLDLPLAGHVVPGARPDLATTTPVGPHPSPAAAA
    LTLWLAALSALAGGLLLNLMPCVFPVLSIKVLGFATHDDRPSTLHKEAFAYATGVVLTFVALGLALFALRAAGEQLGWGF
    QLQSPVVVTALAALFFVLALNLSGVFEFGQFAPASLIGLSARRRSLDAFAAGVLAVVVASPCTAPFMGAALGFALAGSAW
    VTLLVFAALGIGMALPYVLLACFPGWRQHLPRPGAWLGRFKQLLAYPLYATVIWLVWVLGAQTDNDSVVRLLLALLGIGF
    ALWAWRILREGGTRLWAAAIAVALLGVALVAWPLLTGSHEVRVNTPKGTGTAATSDSEWEAFTPTRLAELSGAGRTVFVD
    FTAAW
    CVTCQVNKRLVLNDGEIRSAFAHKQVALLRADWTRRDPAITQALTALGRSGVPVYVLYRPGREPLLLPEVLQRQT
    VLAALAPL

    >gi|257093254|ref|YP_003166895.1| glutaredoxin [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MYITPKRCPRCRYERKPSDTAPDWQCPSCEVAYNKAEEAASVRPLPTQGARPVRRSGGRLWFVVALVLLAAGGMYAMQDR
    HRERGAATRSATTQPEVVMYATTW
    CGYCARARAFFAEHSISYVELDIERDARAEQMNRLLGGGGIPTILVGKDGLVHGFD
    ERALSRMLGPWMRAPSASSR

    >gi|257093330|ref|YP_003166971.1| beta-lactamase domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MIFEQVATGGCQSYLIGCSETSGAALIDPEITQIDHYIALAARDGLRIRYLIDTHTHADHFSATRQLARQLGVPVVMHRA
    SPAPFVDMRIGDGEMVMLGKLRLQAIHTPGHTADSLCLRVEDRLFTGDTLLFGATGRTDLPSGDPEALYDSLFHRLLRLD
    PNLRIFPAHDYKGRQSSTIGQEIASNPRLQKQERADFVAMMRNLNLSMPTHVTEALRTNMSGGKSVAQLLAEAALRVPFM
    SLEELRARVEAQEDDLIVLDVRERDAYEVGHVPGARLLPRGQLELRVNQELSDPTRRILT
    CCELGYVSTLAASTLREMGF
    LHTVALDGGMKAWREAGYPLATGPAMTRAAPAAG

    >gi|257093387|ref|YP_003167028.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MKLLTTLLLSIALLLPGCSGPPAFKSTDITGSDWGKEFALTDPQGQARRLADFKGKAVVLFFGYTQCPDVCPTTLASMRD
    VLARLGDDAKRVQVVFVTLDPVRDTPEVLAEYVKAFHPSFIGLHGDEATTAAVARDFKVFYAKQAGSTAGSYSIDHSTGS
    YAFDPQGRLRLLVRHGETPDNVAADLKLLLAGK

    >gi|257093428|ref|YP_003167069.1| dihydrolipoamide dehydrogenase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSQIIEAKVPDIGDYHDVPVIDVCVKAGDTVKSDDPLVTLESDKATMDIPSSVAGVVKEVKVKLGDKVSEGAIVVLIETA
    GVAEATAVVTPVAAASTVPPASAAAAPQAAAPITGKADLECEMLVLGAGPGGYSAAFRSADLGMQTVLVERYPTLGGV
    CL
    NVGCIPSKALLHIAGVMEEAQHMGDCGVSFAAPNIDLDKLRAHKDKVVGKLTGGLAGMAKGRKVEVVQGVGQFVDPHHLE
    VALAGGGRKLIRFEKAIIAAGSQPIALPFMPDDPRVVDSTGALELRQIPPRLLVVGGGIIGLEMASVYSALGSRITVVEL
    GGVLMPGADRDLVKVWEKKNAHRFDRILLNTGVVAAAASAAGIEVSYSNGEKEVFDLVLVAVGRSPNGRKLAPKSGVAVT
    ERGFIPVDTQLRTNVPHIFAIGDIVGQPMLAHKGVHEAHVAAEAANGGKRCFDALQIPSVAYTDPEIAWAGKTEEQCRVE
    GITYGKSVFPWAASGRALANGREEGFTKLIFDEGTHRIIGGSIVGTDAGDLIGEVCLAIEMGCDATDIGHTIHPHPTLGE
    SVGMAAEVYEGVCTDLPAVKKR

    >gi|257093541|ref|YP_003167182.1| Glutathione peroxidase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTAPLYQFSADRLAGGSQSLGDYAGQVLLIVNTASHCGFTPQYEGLEALYQRYRERGFVVLGFPCNQFGAQEPGDADEIA
    SFCQMNYGVSFPMFAKVEVNGDGAHPLYQYLKKAAPGLLGSEGIKWNFTKFLVNREGEVTERYAPASTPETIARHVEELL


    >gi|257093607|ref|YP_003167248.1| iron-sulfur cluster assembly protein IscA [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MAVTLSERAASHVANYMVKRGKGIGLRLGVRTSGCSGMAYKLEFADVSHPDDIEFESHGVRVLVDAKSLPYLDGTELDYA
    REGLNEGFRFNNPNVKDACGCGESFNV

    >gi|257093712|ref|YP_003167353.1| selenide, water dikinase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPRKKSRIAELPVSQATSSEPVRLTQFSHGGGCGCKIAPAVLEQILGKVSPGLAPSQLLVGIETSDDAAVYQLNADQALV
    ATTDFFMPIVDDPFDFGCIAATNALSDVYAMGGWPLLALAIVGMPVSKLPLETIKRILEGGESICAKARIPIAGGHTIDS
    VEPIYGLVAIGLVHPDNLKRNSGARAGDKLILGKRLGVGFYSAALKKGLLSSPCYASMIASTTQLNTPGRALGCLAGVHA
    MTDVTGFGLLGHLVEICKASSVAAVVDFAALPLLSNVLDYGAKGCITGASGRNWASYGEHVALPKKSFSDLERALLTDPQ
    TSGGLLVACAPEVVTEVLAIFLQEGFDHATVIGEVSEGKPQVSVIRSH

    >gi|257093714|ref|YP_003167355.1| copper-translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPQTLRTVELAIEGMSCAACSTRIEKLLNRLPDVEAVVNLATERATVRYLPGVVDPPLLIATIERAGFVGRLADENSRAQ
    ERARRLATRQADVRRFWIAAALTLPLAAQMLNMFDVSTHHQTDLLPRWLQLLLATPVQFWIGWRFYDGAWKALRGGGANM
    DVLVALGTSMAYVFSAVVTITGAADLHVYFEASAAVITLVLLGKLLEARAKARTTEAIEALLRLQPRTARVERDGRLIEL
    DAALLIPGDVLIVRPGESLPVDGEVLDGSSTVNEAMLTGESMPLAKRPGDRVFAATANGEGMLRCRATSVGEHTLLAGII
    RLVAEAQGSKAPVQRLADRISAIFVPIVCVIALCTFVAWWTLGGVFSAALVNAVAVLVIACPCALGLATPTAIMVATGRG
    ATAGILIKNGEALERAEKVSVLAVDKTGTLTRGEPVLTDILPLATSADAALALAAALEQASEHPLARAILQQAQVAGLAL
    PGLTEFRAIPGRGVEGCVAGRTLRLGAPDSFTCALPRELIATLQGVGKTVVVLVEGGDAEAGDGAALALLAIADPLRETS
    RPAVSRLRSMGIQVVMLTGDHASTAAAIAAEAGIVDFRAGILPGEKADAINALKSGEAVVAMVGDGINDAPALAAANVSF
    AIGAGSDAAIEAADVTLVRSDLNGIADAILLSRATLRKIRQNLFCAFIYNVLGIPLAALGMLNPVIAGAAMAMSSVSVVS
    NSLLLKRWRAAEQTKRAP

    >gi|257093845|ref|YP_003167486.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MIDQTVDDFSLPATGGQTFTLSSCRGSTVVLYFYPKDSTPGCTTEAQEFRDLHAEFVKTGAIVVGISRDSIKSHDNFKAR
    QNLPFDLLSDSAEELCTRFAVIKLKSMYGKQVRGIERSTFVIDGKGVLRHEWRGVKVAGHAQTVLDCVMQLRAASTVV

    >gi|257093859|ref|YP_003167500.1| peptide methionine sulfoxide reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MMKSDSEIATLGGGCFWCLEAVFEQVVGVESVVSGYSGGHLDSPSYAAVCNGGSGHAEVVRIVFHPLQCSFQQILEVFFA
    IHDPTTPNRQGNDVGTQYRSVIFCHTDEQEREARAVIAELDSERLWSAPIVTEVLPAARFFAAEPYHQQYFRRNPDQGYC
    QVVVSPKLAKFRKRFSARLKANQ

    >gi|257093878|ref|YP_003167519.1| thioredoxin reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTPATRHCRLLILGSGPAGYTAAVYAARANLQPVLITGMAQGGQLMTTTDVDNWPADAKGVQGPELMQRFEEHARRFETE
    IIFEHIHTAQLAQRPFTLIGDSATYTCDALIIATGASAQYLGLPSEEAYSGRGVSA
    CATCDGFFYRNQPVAVIGGGNTAV
    EEALYLANIASHVTLVHRRDKLRSEKILQDKLFAREKAGKVTIRWNCLLEEVLGDSSGVTGMRIRNKLTDATEDLSLMGV
    FIAIGHKPNTDLFAGQLAMEGGYLLTQGGRHGNATATSIAGVFAAGDVQDHIYRQACTSAGSGCMAALDAERYLDSLGLA
    G

    >gi|257093967|ref|YP_003167608.1| dihydrolipoamide dehydrogenase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSKQFDVVVVGGGPGGYVAAIRAAQLGFSVACCESNPYADPKGEPRLGGTCLNVGCIPSKALLHTSHLFEEVGHNFADQG
    ICVGAPIIDVARMSARKNAIVKQLTSGIKGLFKKNKVTLLNGHGAFVGRKASGESEVWQLRVGQEMVEAKQVIVATGSKA
    RHLPGVPVDNEIVCDNVGALDIDAVPKKLAVIGAGVIGLEMGSVWRRLGAEVTILEALPDFLSVTDVDIAKEAAKVFAKQ
    GLKIITGIEIGDVKVSQKGVSIDYTDKDGSAQKLDADRLIVSIGRIPNTDGLQAEKVGLKLTERGQIEVDSHCRTNLPGV
    WAVGDVVAGPMLAHKAMEEGVMVAEMMAGQSGHCNFDTIPWVIYTSPEIAWVGKTEQQLKAEGIAFKAGKIPFAANGRAL
    GMGEPTGFVKMLACAETDRILGVHIIGANASELISEGVVAMEFGAASEDLARICHAHPTLSEVVHEAALACDKRPLHF

    >gi|257093971|ref|YP_003167612.1| hypothetical protein CAP2UW1_2394 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSQATSQAIFFHAGCPVCVAAEQQFVQALDPTRYRVEVVHLGEAAGRVSEAESFGVQSVPALVIDGQAFHINFGAPLSAL
    K

    >gi|257094113|ref|YP_003167754.1| heavy metal translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNIDNCYHCGQAVPNGVDLAVSIDGKPRAMCCGGCQAVAQAIVANGLAEYYRNRDALPDSPREALPAIVDRLQLYDHADF
    QKSFVRLVGEGGSEREAALILEGIT
    CSACIWLNEQHLSQLAGVTAVDINYATRRARVRWDERRIKLSDILAAIAAIGYRA
    YPYDAARSEALARRERRSALWRVFVAGFGMMQVMMYAVPVYLAGAGEMTPEVEQLMRWASLALTLPVIFYSAAPFFGNAW
    RDLRLRRVGMDVPVALGIGAAFAASVWATLVGGGEVYFDSVTMFVFFLLSGRFLEMTARQRAVSVTEALARLMPAVAERV
    PAYPASREIEQVMAADLRRGDVVVVRPGETIPADGEVLEGESCTNEALLTGESAPVSKRPGAAVTGGSVNIESPLLVQVV
    QVGEGTRLSAIVRLMERAAGEKPRIVELADRIAGRFIIALLILAAAVAVSWSFIDPGQALWITVSVLVVTCPCALSLATP
    VALTVASGAMAKAGLLVTRSHAVETLARATHFVFDKTGTLTSGRMQLLAVLPLGALDPNESLALAAALEQASEHPIGAAL
    RDAAIGDDRPAVTSLINEPGCGISGLHGGRGVRLGRPDYVQALHGKSLPEAGQAMLAVGDTVIALGDEAGWVALFRIGDD
    LRPEAAVMVAALQASGQQVTLLTGDAAPAARRVALALGIDEVQAEASPQAKRDYVRRLQASGAVVAMVGDGVNDAPVLAQ
    AQVSVAMGGGSQLARTQADLVLLSENLDHLRRGVFVARRALRVLRQNLMWSFAYNLVALPLAMSGFITPWMAGIGMSGSS
    LLVVANSLRLQKTEGN

    >gi|257094126|ref|YP_003167767.1| Disulphide bond formation protein DsbB [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MHLSLRARFGLVALAAFGLTAAGLLIGEVMNLQPCPLCIFQRLLYLLIGCLAVVGALLPGWGRLWAALLGLTAVGGLATA
    GYQSWLQYFPTASME
    CGFGEPTLIEQIVDWFGVLWPAVFMATGFCSSKDWMFLGLSMANWSGLCFLAFAIVAGSMLAKPA
    AAGVRAA

    >gi|257094149|ref|YP_003167790.1| Rhodanese domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLRHRFVCAFALLVALSARADVVDIDNAELARLAAAGVPVIDIRTEGEWKESGIIPGSRLLTFVDERGRTDAAAWLAKVQ
    AVAKPEQPVIVI
    CRSGNRTRAASQLLAQQAGYQKVYNVKDGIRSWAGDGRPLVAAPTALVTCAAGSRC

    >gi|257094265|ref|YP_003167906.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MACAPVLGGSGVHASELAKVRATRLPTPIDGRLNSLIATHPGQPVLVNFWASWCEPCREEMPSLQRLADRSRRAGLVVIT
    VAVADRLDQVDRFLADHAIQLPVVDDRDQVISRAWGARVLPGTVLLDRHHRIRLRGQGAIDWDSPTAGRHLHPFLKPPK

    >gi|257094319|ref|YP_003167960.1| thiol-disulfide isomerase and thioredoxins family protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MKSIKVLGTGCANCRATVALVESVAKEKGVDISIEKVEDLPDIMSYGVMSTPGVVIDGRVVHAGGVPTRAKVEGWL

    >gi|257094344|ref|YP_003167985.1| arsenate reductase and related [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTIFGIKNCDTMKKAFAWLAANGVAYDFIDYRQAGVAAAHLPDWNRRVGWQALLNTRGLTWRKLAAAERAEVDEARALQL
    MVEHPSLIKRPVLDTGKDLLVGFSVASYTCLVD

    >gi|257094392|ref|YP_003168033.1| Radical SAM domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MHVTLPLLMTTDFPALTRRSVETVQVNLGYRCNQSCLHCHVNAGPQRKEEMTAETIDALLAFIAASPEVKVLDLTGGAPE
    LNPNFRRLVIAGRQRGLRVIDRCNLTILEEPGHADLAEFLAMHRVEVVASLPCYLGENVDRQRGKGTFDASIRALRQLNA
    LGYGLPATGLVLNLVFNPQGPVLPPPQAPLAAAYREHLGGEFGIVFNQLFTLTNMPIQRFGSMLVSKGQFNNYMQLLRSA
    HRDDNVEQVMCRNLLSVDWQGYLYDCDFNQQLGLPIGRAGRPRLHLTDISAAALDGCAIRVADHCYGCTAGQGSS
    CGGAL
    GDEVAAAPTCGA

    >gi|257094394|ref|YP_003168035.1| SNARE associated Golgi protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNIRRLLLLAALAALVLTYFGLDLGRFLSLDYFKSQQAAIEAWRAAQPLKAALAFFVAYVAVTGLSLPGAAVMTLVGGAV
    FGLFWGLLLVSFASSLGATLAFLVSRFLLRDWVQKRFGDRLRAINAGVEKEGGFYLFTLRLVPVFPFFVINLLMGLTPIR
    TWTFYWVSQIGMLAGTLVYVNAGTQLAKIDSPAGILSPALLGSFVLLGLFPLIAKKIVGTLAARKVYAGWQRPARFDRNL
    IVIGAGSAGLVTAYIAAAVKAKVTLIEKHKLGGD
    CLNTGCVPSKALIRSAKLLSHMRRAQEFGIRSARAEFDFADVMERV
    QRVIRTVEPHDSAERYSGLGVEVIEGTATIVSPWEVDIVRNSGESERLSARSIVIATGARPFIPPIPGIEAVGYFTSDTV
    WDLRELPRRLLVLGGGPIGCELTQAFARCGASVTQVQHGPRIMVREDPEVSELVMQRFRAEGIAVLVNHEARKFVIEDGE
    KILVAEHQGQEVRIPFDALLVAVGRVANIAGYGLEELGIAAGRTIETNDFLQTKYPNIYAAGDVAGPFQFTHTAAHQAWY
    AAVNSLFDPFRKFRADYSVIPWATFVEPEVARVGINESEARERNIAHEVTVYGIDDLDRAIADGEAHGFIKVLTVPGKDR
    ILGVTIVGEHAGDLIAEYVLAMRQGIGLNRILGTIHIYPTLAEANKYVAGNWKKAHAPQKLLAWVARFHAWRLGQA

    >gi|257094405|ref|YP_003168046.1| uncharacterized peroxidase-related enzyme [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MEPPISRFPIPALGELPEDVRNRILAVQEKAGFVPNVFLTLAHRPDEFRAFFAYHDALMEKESGVSKAEREMIVVATSGA
    NQCQY
    CVVAHGAILRVRARNPFIADQVAVNYRKADLTQRQRAMLEFALKVALRSAEVGEADLAALREHGFTDEDIWDIGA
    VAAFFAMSNRLANMSSMRPNDEFFVMGRLPKA

    >gi|257094520|ref|YP_003168161.1| electron transport complex, RnfABCDGE type, E subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MINREEFRQIRDNGIWQQNTSLVQILGLCPLLAVTTNLVNGVMLSLATIIVMAIANLAVASLRNLIPHEIRIPVFILIVA
    ALVTVVDLVFNAQFHELYLVLGIFIPLIVTN
    CIVLARVEAFANKNPPLQSLIDGVFMGVGMLWTLALLGGLRELIGGGTL
    FAGIDMVFPALQPLQLLPADYPGLLLAILPPGAFILLGCLIAWKNWVEARVAARNPGPGQHQAPPVALTDGA

    >gi|257094525|ref|YP_003168166.1| electron transport complex, RnfABCDGE type, A subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTHYLFIIVGAVLVNNVVLVKILGLCPFMGVSRKLETAFGMGAATTFVLTVATGASYIIDHYLLMPFGLEYLRTLSFIVT
    IAAIVQLTEMVIQKTSPLLHQVLGIYLPLITTN
    CAVLGVPLLNIANKHDFVESLLFGAASAIGFSLVLILFAGIRERIEG
    ADVPVYFRGTAIAMVTAGLMSLAFMGFAGLDKYQ

    >gi|257094579|ref|YP_003168220.1| OsmC family protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MECRVKWAGEGMSFVAETGSNHVVVMDGAPEAGGRNLAPRPMELVLAGTGGCAAFDVVLILKKGRQAVTGCEVSLQAERA
    EAEPRVFTRIHFHFRVTGKQLKAEAVARAIELSKEKYCSASIMLGKTAAITHDFEIVEA

    >gi|257094592|ref|YP_003168233.1| iron-sulfur cluster assembly accessory protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNAATEMPLPFVFTDSAAGKVKELIEEEGNPDLKLRVFVTGGGCSGFQYGFTFDEVANDDDTALQKNGVTLLVDPMSYQY
    LVGAEIDYTEGLEGSQFVIKNPNASSTCGCGSSFSV

    >gi|257094621|ref|YP_003168262.1| methylated-DNA/protein-cysteine methyltransferase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSTHAAPEYQAVVAAPGFCLGVRCDEWEIHGISFLPAVAEVAPANPLAAEAARQLTAYLVDADYTFLLPLRAAGTVFQRR
    VWQQIAAIPTHQTRTYGEVARALDNAPRAVGQACGANPYPVVVP
    CHRVLASGGGLGGFARQRGGFLLDIKRWLLTHEGC

    >gi|257094791|ref|YP_003168432.1| Glutathione S-transferase domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTKQIVVCMDGTWNDPVEHTNVYRLFQMLPGEERQIEETGPIRSHLVKNSDQVIAYCFESIGRGGRARGLLGGTQGIGLH
    DCMIDAYLLVSQVYQSGDKIWLFGFSRGAWAARSLGAFIARSGLIPAVHADDDDAADKAEKIWLDYKEGRGMKRGGRFWK
    HHDETPIRMIGVWETVGELGVPLFNGLRLADRDELRFLRFADRELSPRVEHGRQALAIDEHRADFTPTPWAEREGVKQVW
    FAGAHADVGGGYENHGLSDIALEWMMQEINDLDAGLQLAPDQLSEALAPDSLEDRHDETRGPVWRTRPSKARKIPDAAEL
    HPSVVQRLRERADYRPKALEDIPVCTDFYLDEAPRPDETLQPEREALPFRKLPVDGSTCFPAYAHKWWNASGVEVDVGER
    YRIEASGAWIDKEIHAGADGYESKAWLLHLAEGSRRMEERPWFSLVAAIHPRPDLEANNPDSENVLTGLIESTISGVARI
    DDESCLLATPSGCEIEIIEPGFLYFFANDSPFSYSNNRGFLSVEVTRLPWSTDVDQKTSPTHQPVPGSLDVKLYFTPGT
    C
    SLAPHIALREAGLDFDLVRVDIRQRTLTDGSDFLAINPKGYVPVLELEDGRYLTEVPAIVQYIADRIPECGLAPRPYTLE
    RYQLQEWLAFISSELHKAFVPLFRPDTPEDYKRSIKENLAGHLGYVAGRLEGRNYLLGDRFTVADGYLFTVLGWGNAVAI
    DLGQWPPLLAFLERVGQRQSVRDALAAES

    >gi|257094818|ref|YP_003168459.1| OsmC family protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MARDKHEKHDKHDQPVVVSESGQGPYQQSIRVGKHHLIADEPVAMGGADTGPAPFDFLLASLGSCTSITLRMYAERKKLP
    LTGISVELAHDRIDVEGHGKVDRISRTITLQGDLTSEQRSSLLAIANKCPMYRTLQSDIRIESVLATGRPAPVD

    >gi|257094875|ref|YP_003168516.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLKAGEVAPTFVLPDADMELIDIAQFQGRNNVILFFYPRDDAPCCTLQATDFSDHEDEFARLDCRVIGISRDDCIQHAEF
    RDKHGISVSLLSDAEGSACEQYGVWQAKEVAGVKKYGILRSTFVIDKQGVLRLALYGVNAKGHALQMLRAVKELNS

    >gi|257094885|ref|YP_003168526.1| thioredoxin [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSEHIHHVTDDNFGIDVLQSDQPVLVDYWAEWCGPCKMIAPLLDDIASDYAGRLKVVKLNIDDNQKTPASYGIRGIPTLM
    LFKNGNVEATKVGALSRSQLITFIDSNL

    >gi|257094957|ref|YP_003168598.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MKRLLVALLFALPGATGAADGLASAAPLFALTLNSADGQSVALGSLKGKPLLVNFWARWCLPCRREIPDLAAVHARYRGR
    GLVIVGIAVEDDANRDSVREFATAYELNYTSLIGGMPASIDLMQTLGNGKSGLPFTVVIDRGGRIRSSKLGAMSQAEMVA
    AIQSVL

    >gi|257094971|ref|YP_003168612.1| Redoxin domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MKPQHALALAVVAGVLTLASIGFLGYRLLEQSRSVTDGVPAGLISSQQLTPEDAQAAADAVMRLTLPDLAGRQQAMAQWR
    GKVLVVNFWASW
    CAPCVEEMPAFARLQSEYVGQGVQFVGIGIDEVENMQSFVKTRPVTYPLLAATPAISDTPGLRIKGLP
    FTLVIARDGQLAMSRLGRLDEAKLEPILRRLSGQ

    >gi|257095124|ref|YP_003168765.1| Protein-disulfide reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTRWLFTVLLLLTTLVHGEEFLDPAVAFRPTAHAIDGQSIEVRFEIAKGYYLYRDKFRFAAEPATVQLGTPLLPPGKEKS
    DETFGKVEVYYHSVSIRLPVERNSSGPLPLTLKVTSQGCADAGVCYPPQQQKLTLQLPDPTEAVAAPSSPAPATTTDESG
    RIAQLFGSSGFWLLVGSFFGFGLLLSLTPCVFPMIPILSSIIVGAGRDGHGVSHLRGFLLSLAYVLGMAVTYAAAGVSAA
    LTGTLLAATLQNPWVLGILAAVFVALSLSMFGFYELQLPTFLQSRVSEQAGHLKGGSLPGVAAMGALSAVIVGPCVAAPL
    AGALLYIGQTGDAILGGTALFSMALGMGAPLLAVGLSAGTLLPRSGAWMEAVKKAFGVILLATAVWLVSPVIPVVAQMLA
    WGLLLIVPAIYLHALDPLPPHARGWQRFWKGIGIVMLLFGAAMLVGTLAGSRDPLQPLSVLRGTAASSENRPLAFTRVRS
    LSDLESMIRTAGKPVLLDFYADW
    CVSCKEMERFTFADPRVRARLAGWTLLQADVTANSDADRSLLQRFGLYGPPGIIFFD
    AGGNEIKGVRVVGFQSAEEFLSLLARLG

    >gi|257095259|ref|YP_003168900.1| methionine-R-sulfoxide reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MDRRQSLKWLGGLSAFVLPMAAPGHASASDSTGNRLQKSKAEWATLLPLPAYRVLFEEDTERAGSSPLNQEKRDGTFICA
    ACYLPLFDSAKKYESGTGWPSFWDYLPGAVATRTDFKLIYPRTEYHCVRCGGHQGHVFNDGPKPTGKRY
    CNNGVALQFVA
    RSEKLPELRA

    >gi|257095260|ref|YP_003168901.1| peptide methionine sulfoxide reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MIGRRFATALALLFLGASAGAGAADAPDARTPEVRTAIFAGGCFWCIEADFEKLPGVIAAESGYTAGRTVNPTYEQVSAG
    STGHTEAIRVTYDPQKVSYRQLLDYFWRHIDPTVKNRQFCDVGSQYRSGIYWQNEAERKAAESSRDTLLASGKLPRIETE
    IVAASAFYPAEEYHQDYYKKNPIRYAYYRQGCGRDARVQQIWGGG

    >gi|257095495|ref|YP_003169136.1| glutathione peroxidase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSHLLALSFADAAPTLQNACPRLASLVDRNLARSIAKELDTASSAPARRSTRHVLDSPQAPGLTRLRSLLLPAVVLSVVF
    VLASPALAADSCPALLNHSFPSLQDQKPQSLCQWQGKVLLVVNTASY
    CGFTSQYDGLEKLYARLRDRGLVVVGFPSNDFG
    DQEPGSNKEIAEFCRLTYGVQFPMFAKATVVGKNASPLYAQLAKASGDAPQWNFHKYLIDRSGTRVLSFGSRVKPDDREL
    VARIDEFLGK

    >gi|257095509|ref|YP_003169150.1| heavy metal translocating P-type ATPase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSAEAYRNFRVAHRLIRRVRVVAPPLVRNVERCYILEILLRKRPEISEVRAVPEIGSLAIHYDPGRLPEQRLLAIVDGVL
    GNLITCPPARPAASVIDGAPLQEHSLAIEGMS
    CASCALLIELSLRRDPRVQLANVNFAAQTAIVRGTLSRDDVFALVGRL
    GYRAQPMDTLAQRRLLVEREKGQLMLARKRVIVAAALTAPVMLLGMAMHRSPTLRVLEFALATPVLLGPGREIFDRAWRL
    AQQKSANMDSLIALGAGAAYLYSLPGLWRPNHHVYFEAAAGIISFVLLGRFLEERAKGQASEAIRKLIELQAETAVLLCD
    GQEHRVAIDEVVLGDLLRVRPGDRVPTDGVLVDGSSEVNESMLTGESLPVGKRAGDKAYAGCLNGNGTFTLRVTAVGVDT
    VLAGIVRLVDHAQGSKLPVQKLADRISARFVPAVGGIAALTFGGGLLARSHPTTALAHAIAVLLIACPCALGLATPTAIM
    VGTGQAARRGIYIRNGEALETAARLTTVVFDKTGTITEGKPVVTDFIAVEGVDETALLARMAAAEACSEHFLARAISAWC
    LARGAAPAACSDFAAIPGRGVRANCEGVPMLIGNAALLEETGVACIAQAQQVAVLAEQGKTPVFVAMGGRVAALLAIADQ
    PRQGARDAIARLHRLGIETVMATGDLRAVAQHIARQVGIERVIARATPAMKLELIHELQQQGKRVGMIGDGINDAPALIA
    ADVGLAIGGGADIAVEAADVTLLGGDIARVAATVELSRRTMSIIRQNLFWALGYNVVAIPIAAAGRLNPMIASAAMAFSS
    VSVVSNSLRLQKH

    >gi|257095513|ref|YP_003169154.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLRKPLALLSFLAALALTACDEGNTNRLNTGDIAPAFAASSLGAVPFRFPDDLRGQPVVIRFWADWCRFCEGEMKAIERV
    WQRHKDQGLMVIAVNAGQNRQDVAAFISKIGVTYPALLDEKAAISRQYGVVALPTTYFVGADGRIRGKVLGEADEATFER
    LTVDLLK

    >gi|257095554|ref|YP_003169195.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MALNTPVCDFGWPAVDFELADTHGARHSLSTLRGPNGLLLMFICNHCPYVKAIIDRICRDARALQAQGIGVAAIMSNDPA
    EYPEDSLDNMQRVAAQLDFPFPYLYDATQDVARRYGAVCTPDFFGFNRQLELQYRGRLDASGRMPAAPDARRELVEAMRL
    VAESGRGPAEQVASMGCSIKWRS

    >gi|257095631|ref|YP_003169272.1| Rhodanese domain protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSYTTLVNGAVVAERLHDPEWRVFDCRHQLTDPDAGAQAYAAGHLPGAFFLHLDRDLSGPTNGRNGRHPLPDPLRLADKL
    GAAGVGAATQVVAYDDAGGMLASRLWWLLRWLGHDRVAVLDGGIDRWLAEDRPVTTEWPRSEANVLAVAPRDWVVDSEAV
    LGNLHDNRLCLVDARSPDRFRGENETLDLVGGHIPGARNHFFRDNLGADGCFLPAADLRRRFLALLAGRASDEVVMS
    CGS
    GVSACHNLLAMEIAGLHGGRLYAGSWSEWCSDPARPMIRREA

    >gi|257095675|ref|YP_003169316.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MRRSSVFLVGVCAAIIGVLAGSRVGFLRSSALPQSATAVSAAGVARLFASHLNDPAGHSNSLLQWQGKTLVVNFWATWCP
    P
    CREEMPAFSRLQERYAAQGVQFVGIALDSVENVRTYHALSPVSYPLLIGGPEGGALARDLGNKSLSLPYTVVINPQGEV
    RLMQMGALAESDLERILARTADR

    >gi|257095757|ref|YP_003169398.1| glutaredoxin [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MRQSSSLARSCFPVIHLLGAILWLTALCAGQAIAAAEAEGSVLPEIEVFVREGCPHCEAAKRFLADLERERPGLRVTLVD
    IRRDPDALARLDELSRNAGITQPGVPTIRIGAALIVGFDTPATTGAQIRAALDQARFPVAAGETCGLAEAGECKPAAGDS
    VDIPFVGRQIGVNDLGLPLFTIIIGLLDGFNPCSMWVLILMISMLASLGDRRRMLAIAGTFVAIEGVAYFAFMAAWLNVF
    LLIGLSRISEIVIALLAIIAGAINLKDFVAFGRAITLSIPAAAKPGIYARLRAILRADRLWPALLGTAVLAVLVQIVELL
    CTSGFPALYTRILTLRQLDNASYYGYLLLYNLMYMLDDMVILGVGVATLSQRRLQENEGRLLKLLAGLVMLGLGVYLLIP
    ASA

    >gi|257095773|ref|YP_003169414.1| arsenate reductase [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSPTLLRIYHNNRCSKSRAACQLIAEKGVAAEIVDYLKTPPSRDELRELLGKLGMPAADLVRRGEAAFKEHYAGRSLSDE
    EWLDALVAHPILIERPIVVRGDRAVLGRPPEKVLELL

    >gi|257095778|ref|YP_003169419.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNALEVDVAIIGAGTAGMSAYRAALAHTRSVLVIEGGAYGTTCARVGCMPSKLLIAAAEAAHAARHAEAFGVVVDSLRVD
    GAAVMQRVRDERDRFVGFVTEAVDHWPAEHRLRGHARFLDGHTLQVGEHTRVEARRIVIATGSHPNVPAEWREAAGDRLI
    VNDDVFAWQSLPQSVAVLGTGVIALELAQALHRLGVRVGVYGRSERVGPLTDPALQAEARKIFADELPMRLGVSDLHLRR
    VGNEVAVRVGDEEPAAERRYAWILAASGRRPNLQALGLPQSGLPLDTRGVPMFDPCTGQIADSHVFIAGDATHEREILHE
    AADEGRIAGDNAGRFPDVRVRPRRAPLSVVFSDPQIMLAGQSHAQLLRSGADFAVGEVSFEDQGRSRVMLKNRGALHLYA
    ERRSGRLLGAEMLGPAAEHLGHLLAWSVQRGDSVQEMLDSPFYHPVIEEGLRTALRGLQRALRMGPPPIEHCLDCGPGA

    >gi|257095810|ref|YP_003169451.1| DedA [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MELSQISQAVQQDAVTVVFVNVLLQQVGLPVPALPTLLLAGSLAATPGHLGQVLAAAIVASLIADLLWYRAGKFFGYRAL
    AGLCKLSINPASCVSQTEARFIRWGVSSLVVAKFIPGFSTVAPPIAGALRMHLPGFLLAAGAGACLWAGLALGAGWLLKD
    AVQAAIGALDRHTGTALAVVLPLIGAWLGWKLWQKYRFRKSCTVPHITPDELIEALRTEQRPLILDLRGATMIAETDAVP
    GATVAEHDRLDDAVGDWPRSQPIVTLCA
    CPEDAGAIAAARRLLNDGYLSVRVLHGGYDAWLAATGNDPLPRQ

    >gi|257095826|ref|YP_003169467.1| putative thiol:disulphide interchange protein (periplasmic) [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MYKKLIPFALAAFLSLPTLADEASVKKAVEAKIGGPVTSVTKTTYLGLYEVYADGQVLYTDEKVSALLIGSLIDGKTMRN
    VTTERMQKLTAIKFSELPLANAIKQVRGDGKRVFASFEDPN
    CGYCKKMAKEIAKLDNVTVYTFLYPILSPDSLEKSNQIW
    CASDRVKAWNDWMVDGKAPAGKGDCDTTAIKTTLETGRKLAINGTPTIFFADGERVPGAIPLARIEQKLAQTPSSGK

    >gi|257095845|ref|YP_003169486.1| hypothetical protein CAP2UW1_4321 [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MPGHPADDGAKQTDPVRAEFMVICLCAEWCGVCRDYASGFRSLAGQFTAAGFHWLDIEVHADYLGDLDVENFPTLLIKRG
    EKVLFYGTMPPAPAHLKRTLEAFAQQTGEESREYALSSVERRCWQDDMDLRRLGCDDRGRIVGQAPDVG

    >gi|257095890|ref|YP_003169531.1| iron-sulfur cluster assembly accessory protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MIHLTPAAVKAISRFVKATETPVAGLRIFVSGGGCAGLQYGLRLEQDKGDDDLEFDVGAAARLLVDPLSSSMLDGLTVDF
    VDSLTQTGFKFNNPNVAGACACGQSFAG

    >gi|257095912|ref|YP_003169553.1| electron transport complex, RnfABCDGE type, E subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MKQLVQTLKDGLWLQNVVFAQMLALCPTMAVTTSGTNGLGMGLATTAVLVTSNVLVASIRSLVSPQVRIPIFVVLIATLV
    TLVDFGLNAWLHDLYKVLGLFIALIVVN
    CAILGRAEAFASKNTVAASAVDGLAMGLGFTGALTLIGLIRELLGSGTLFAQ
    ASLLLGPAFRAIELTVIPGYGGFLLMILPPGGFLVLGLLLAGKRAFELRAREANKAVVPAPALA

    >gi|257095917|ref|YP_003169558.1| electron transport complex, RnfABCDGE type, A subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MTAYFLLLLSTALVNNVVLVKFLGLCPFMGVSRNMDSALGMGLATTFVITLACAATWMLEHWLLAPFDLGYLRILTFILV
    IAATVQFVEMVVKKSAPALYQALGIYLPLITTN
    CAVLGLALLTAQEKMSFLKSLVYGFGSALGFTLVLLIFAGLRERLAL
    ARVPAAFAGAPVSFILASLLSLAFMGFAGLSFS

    >gi|257095942|ref|YP_003169583.1| nitrogenase-associated protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MAEIIFYEKAGCAGNARQKALLVASGHQLVVRDLRGQFWSNVRLLEFLADLPVAEWFNPAAPAIKAGTIVPQQLDERSAL
    ALLRHNPLLIRRPLLQVGEERRVGFDVAAIDAWIGLCELPVGDLEACRRDRGEVRTFHVQTAGGAAYPCRFDDQQADASR
    CRP

    >gi|257095951|ref|YP_003169592.1| NADH:ubiquinone oxidoreductase, subunit D [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MNTSTSAKPRALAVLFAPVFDNNPIALQILGICSALAVTANLKTALVMSVALTLVTAFSNLFISLLRHHIPGSIRMIVQV
    VIIASLVIVVDQVLRAVAFDLAKQLSVFVGLIITN
    CIVMGRAEAFAMQNPPLPSFLDGIGNGLGYSALLVALGITRELFG
    SGTLIGFRVLPTVADGGWYLPNGLLLLPPSAFFLIGLFIWALRSWKPEQVESPAFRMAPQVREQEP

    >gi|257095952|ref|YP_003169593.1| NADH:ubiquinone oxidoreductase, subunit E [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MEHLLALFVRAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVMLVQTITVPVNNLIYTHVLREGALAWAGLPESDLA
    FLGLLTYIGVIAALVQILEMLLDRYVPALYNALGVFLPLITVN
    CAILGGTLFMVERDYDFAESAVYGLASGFSWALAIAL
    LAGIREKLKYSNPPAGLSGLGITFITIGLMSLGFMSFAGIKL

    >gi|257095973|ref|YP_003169614.1| peroxiredoxin [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MSLINTEIKPFKATAFHNGKFGPVSDADLKGKWSVVVFYPADFTFVCPTELGDLADEYASFQKIGVEVYAVSTDTHFTHK
    AWHDASDTIKKIQYPMIGDPTGTITRNFDVMIEEEGLALRGTFVINPEGVIKVCEIHDLGIGRDAKELLRKVQAAQYVAS
    HPGEVCPAKWTPGDATLAPSLDLVGKI

    >gi|257095974|ref|YP_003169615.1| alkyl hydroperoxide reductase, F subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
    MLDANIKTQLTAYLEKIRQPIELVASLDGSEKAGEMWALLQDIAALSDKVSIRNDGVAPRKPSFAVARAGEPARIRFAGI
    PMGHEFTSLILALLQVGGHPPKAEASTIEEIRAIPGTFHFETFISLS
    CHNCPDVVQALNLMAVLNPGISHEMIDGALFQD
    EVTSRQIMGVPTVLLNGEHFGQGRMLLEEIVGKIDTGALQREAEKISAREPFDVLIVGGGPAGAAAAIYAARKGIRTGVV
    SERFGGQVLDTLGIENFISVSQTDGPKLAAGLEQHVREYDVDVMDLQRAEALLPGSDGGPSEIRLASGAKLRSQTVILAT
    GARWREMNVPGEKEYRGHGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVAHVTVLEFDSILRADAILQKKLFS
    LANVKVITSALTTEVTGDGKKVNGLVYTDRSSGEAHRVELEGVFVQIGLLPNTEWLKGTIALSPRGEIEIDARGETSLPG
    VFAAGDVTTVPYKQIVIAMGEGAKASLSAFDYLIRSSVT