Campylobacter lari RM2100 uid58115

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222823402|ref|YP_002574976.1| putative integral membrane protein (DUF395 domain protein) [Campylobacter lari RM2100]
    MHSFKQSFFINFWDNSKGMIVLGILSAIYFGIFGSVWAVTGEMTRWGGEFLEFFGIDLSSYSYYQKQNLSGSPLTRIDGI
    MLIGMFIGCLSTAFLANKFKWRLPASKIRIFQAIIGGILSGFGARLAFG
    CNLANFFTGLPYFSLHTWVFTLFMILGIYLA
    VKVCNLAPFKPKAKLQRVCKENQPLKTQNKTTKIYFYIGLGIFIIFITYVVFVLQKQPLNIKNKESILPLALIFGFIFGF
    IISRAQICFTSCFRDLFLFGRDNAIKGALIGMIIACLIAFAFILQGHTSKIIEISPNIALGAFLFGFGIVFAGG
    CECGWM
    YRACEGQSHFIIVGIANIIGTMILALSYDHFPNFLTDGVKIHLLNEFGYFNGLVINLILFAILFLFILKFKKSFFFKQNK
    KGEI

    >gi|222823497|ref|YP_002575071.1| heavy metal translocating P-type ATPase [Campylobacter lari RM2100]
    MKCKHCQLSFRQDQMIEKNGNYFCCKGCESVYEILQENNLEEFYEKLGNQTLTPAIIEHNVKDYEKYIQKTKEGFSEIFL
    LIEEIH
    CAACVWLNEKILIKSEGVIEVDINSITHKARIVFDEKSINLAKIIQSIESIGYKASVYLPTKNEQRATQTKRDF
    YAKLIVAIACVMNIMWISVAKYAGFFSGMEADTKDILHFAEFLLCTPVLFYTGSIFYKNAYYALKFKSVNMDTLVISGAS
    LAYIYSVWAMFSRASQVYFDSVAMIICFVFIGKYLELLSKKKALDTLDHLRSFLSNEVRVLKNNKIENIDVEEVQIGDII
    ELKEGDRVLIDGVCISGNISLDMSSLSGESLPLDVQKDDMIYSASLVLSGNALYKANAFYKDSKLARIINLLENSSSKKA
    KIEKMVQQVSKYFSPIILTCALLCFAFTFFVLNLGFEEAMMRMVSVLIIACPCALALATPVSSLVAISTGLKEKILFKEA
    GVVEDLSKCNVAVFDKTGVLTKASLEVKKSFLDERLDKNELLNFLHLTNHPVAKSILNFLDEKIDSRIEFEKVQNFQARG
    YKAFLGKDEFLGGNEKFFKENHIQAQEFQTTHFIFAKNKTILAVFELEDSIRESSEELIRFMKECKMQIYILSGDNLHAV
    SKVAEKLKINNFKASCMPEDKMQIIANLNQTGRVLMVGDGVNDALALSYAGVGVSLKEGSELAMENSDIILLKNDLKSLQ
    KAMQIAKKTYQIIKQNLAFSLFYNALSMPLAFFGLINPLIAALSMSFSSIIVILNALRIKK

    >gi|222823570|ref|YP_002575144.1| thiol:disulfide interchange protein, DsbA family [Campylobacter lari RM2100]
    MQINQKIHKLIIFLAFMFAINAQALSEGKEYITLKTPIPNAQNSLIEIFSYRCIHCYTHHQFHTLAKVKEALPNLKYDLF
    SVSSMSKYGGALNEMFALASFKEKALGLDVASEKSLTYKLADVYFISHFEQKLNLNNLDLFYKIGLNAIGASKEELQKFL
    QTKESRELLAAYEMANEISRNYGTPAFVVNGKYQINPEYITSLEELIRIVKELSAK

    >gi|222823707|ref|YP_002575281.1| rhodanese domain protein, putative [Campylobacter lari RM2100]
    MKKVFLSLALCASFVLAEVKNIDINAEILENYQVIDVRKPSEWAQTGTIKNAIKISFYNEDGSVNKNFVEEIKKISSNKP
    IAIV
    CRSGSRSAKASALLDQNGIEVTNLKGGMNALLSQGYETSK

    >gi|222823787|ref|YP_002575361.1| thiol peroxidase [Campylobacter lari RM2100]
    MNSVLFKGNKVNLKGNNIQVGDMAPNITLKAKDLSGVEIAPKGKTQIIISVPSLDTPVCATEAREFNKKAAASGVEVIVV
    SMDLPFAMGRFCSTEGIDNLTVASDFVSKEFGEKYGVLMADGPLEGILARAVFVVKDGVVAYKELVNEVTELPNMQALES
    FFGQSCGCGGCGCH

    >gi|222823790|ref|YP_002575364.1| peptide methionine sulfoxide reductase [Campylobacter lari RM2100]
    MTNKEIILGAGCFWCTQAVFDKIKGVVYTEVGYSGGKPNPSYESVINGDENIEVAKIIYDEKQISLEKILEIFLKMHDPT
    SLDKQGADEGMQYRSVIFYQTNDELKIISDFLQKVQKYYAKAIVTQVLKLEKFYKAEDYHQKYFKNNPNQAYCRFVITPK
    LEKLVNHS

    >gi|222823908|ref|YP_002575482.1| thiol:disulfide interchange protein DsbD [Campylobacter lari RM2100]
    MRFLAVFFIFFNLAFANNGVLSLNEAFKLNTHSNNQGIFLKINLADRIYLYKDQIKVELDSNDITSLLNFPQTQTRENKE
    VIFSQLELFIPQLLLDDFIKNNKAKLSLAYQGCSEEGLCYRPVYVNYELNKQNGIYTIKSTKDQFKKQNEDEQIANDLST
    QSIFITLLTFFGYGLLLALTPCILPMIPILSSLIAMKLKDKPSKKYSFYLSFIYVFFMSLAYAIAGALVGLAGANVQGLL
    QQPWIIIAFAGIFVLLSLSMFGLYELQLPLKFQNFINKKIEGKSGIFGVAIMGFLSALIVGPCVAAPLAGALLYITNSGD
    VFLGGLSLFVMSFGMGMPLLLIGLGGSFLKSGAWMLKVKIFFGFIMLIMAVWMLERILSANIILMLYGIIGVFFTSFMGL
    FDEVKTNFDKFKKASMILILVYSISLILGGSMGSKSMLKPLEFNLAFKENSSSLSFKTIKNLKELKQELQNSTKPIMLEF
    TATW
    CENCKLLEEYTFTDTKVQNLLANYTLLKADVTHNSQEDLALMKEFGVFGPPVMIFFDKNEEKGRIIGYVDANDFLS
    KVP

    >gi|222823973|ref|YP_002575547.1| methylated-DNA--protein-cysteine methyltransferase [Campylobacter lari RM2100]
    MYQNFYKASFAYILLQSDKNKLVNVDFTIYKPDFTKDKHPILEQALEELDLYFNKKLFTFNTPLTLQGSEFEQKVYKALV
    KIPYGQTKTYQEIASFINHPKAFRAVGNANSKNKLAVFIP
    CHRVVAKNHLGGYNGGLFIKEALLKLEGVL

    >gi|222823989|ref|YP_002575563.1| conserved hypothetical protein, ArsC family [Campylobacter lari RM2100]
    MLKFYGIKNCNSVKKAMDYLNSKQIEFEFLDIKKLDEKTLDFWLSKRSVLELVNTAGMSARKIGLSKEKLQNLNQDEIKV
    MVLQSPTLIKRPLIVKDDEVFIAKEYENF

    >gi|222824060|ref|YP_002575634.1| possible periplasmic thioredoxin [Campylobacter lari RM2100]
    MKKFAYLFFTFAFAFLISSCSSEEKIENEFAFAEYKLGDEILLKSINGGEKTLVRKEKGFVVKGEEDKILMFDFFGTFCT
    PCQEEAPHLTSLWQKNSNNFIIIGLSHFENVSDEAVKDFAIKYGAYYFLSNSKENDRIVAQALKDINYQNMEQLPFKVVL
    KNGNYQNLTNFWDKDSKQFVKFYLGKVSTEVMQDDITRILNESKK

    >gi|222824077|ref|YP_002575651.1| cation-transporting ATPase, P-type [Campylobacter lari RM2100]
    MRHELRLKIGNMTCVNCSNAIEKVCAKIDGVEDVSVSYVNSSGVFLLKDLSLETKIKEKIKALGFEILQEEQNLYEFKLK
    ELKNMKIKLIMSIILSSIVMYFEMFVQGNVSALIQMLLSMIAIFYCGKGFFIHALKGLRYKKLDMNTLISLGAFTSFIYS
    FFVYFEIFSKDGYLYFSGGAMIISFVLLGKYLEEKAKFKSLKYQNKLKNIDIKKANIILEDGSIKSIPSAFVKENDVILV
    KEGESVVADGVIIVGEAEVDVSFLTGEFLPLFKKQDDEILAGTVLINGNLKIKANKKAIESSLEQIKDLVFKAGNVKTPL
    ANLANKISAYFVACIIVLSLFVFAFWYVKEGINAAFLHACATLLISCPCALGLATPIAIVSALANGARNFILVKNPAVLE
    NLASIKLAIFDKTGTLSQDDLSVYKHNLTQENFQKLTQIENLSSHPIAKAFAKELNVNLNLQGKLSVLVGSGLLYEENDD
    VYLIGNEKLMLENGVDIQKSKQFLQEFEDQAPICLYFAKNNICLGGVCLKNELKNEAKKLIANLKQKGIKSIILSGDNKN
    SVAKIANELNIDEYYSDLKPSQKLDFIKEKIKEEKVLFIGDGINDAPALNLASASISFSKASELAKKSGDLILIKDDLSL
    IAYCFELSQKTKNIIKLNLFWAFIYNALCIPIAAGFVPFISLSPHLAALAMCFSSVTVVLNSLRLR

    >gi|222824163|ref|YP_002575737.1| conserved hypothetical protein, possible lipoprotein thioredoxin [Campylobacter lari RM2100]
    MKIKNIILACLCLVFLSACFENNNKNGGKIGLKAPEIAAKNLQGEKIKLADFDNLIVLTFVEQGCASCLKDLPLLEKLAN
    EYPKKITILALDSIDKGRDFEEFATKYDYKNITFLQDDLDISWQRFSVFAVPTTFVIKEGVVQDKIIGEKPWSQLKASIA
    SWL

    >gi|222824210|ref|YP_002575784.1| conserved hypothetical lipoprotein [Campylobacter lari RM2100]
    MKFKIFLVIFIMIFFTSCSSDKENSSTENTDNASLTQSENTDFTLKFLDGRKMYVKYHEQEFSFDDTAKAKLFVFFTTWC
    AP
    CKAQIPHLNNLNKKYQDRFEVIALFLEENKEQEILTFIEDEKMKFPVAIGENNFVFSKVLNISSIPTMVLFNAKGEKI
    KEYLGIIPEEMLDIDIQKVIM

    >gi|222824220|ref|YP_002575794.1| thiol peroxidase [Campylobacter lari RM2100]
    MSSITYKDQNIELAGVELEVGDNAPRVVLRTKNLAPVEIAPPGKTQILLTMPSLDTPVCSKQAKETNKRLASMKNIEVII
    ISMDLPFAMDRFCATEGVDNIITASDFAFKDFGINYGVLINNSIFAGLLARAAFVVKDGKIVYKQLVEELMGKIDFRGLE
    LFMHRNYGYPLN

    >gi|222824283|ref|YP_002575857.1| hypothetical protein Cla_1288 [Campylobacter lari RM2100]
    MKKSLALLTLASSLFAASNEEIINFFKKNPNLSNANISVSSREKIPDANFEAVIVNFEIGGKNFQEIVFTQDNIITTEVI
    DVKKGEFYSQVYQAKLMEKQQAEFSKKALVELKKEKMFISLGDKNKPLLYVFSDPE
    CPYCRIHLDKIEETLKTHQVKFIL
    TPIHDTSAFEKSALIYKESKNAKDDAQKIAIMKKYYDKDIKDYKKPSEAEVKAVRETFAKYSKLGLRAVPTIIDAQK

    >gi|222824325|ref|YP_002575899.1| alkyl hydroperoxide reductase C22 protein, AhpC/TsaA family [Campylobacter lari RM2100]
    MIVTKKAIDFTAPAVLGNNQIVEDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQDFKDRGIEVIGVSCDNEFS
    HFAWKNMPVNQGGIGQVKFPLVADLTKQIARNFDVLFGEAVALRGSFLLDADGTIRHAVINDLPLGRNIDEMIRMVDTML
    FTNEHGEVCPAGWNKGDEGMKADPKGVADYLSKNEGKL

    >gi|222824395|ref|YP_002575969.1| bacterioferritin comigratory protein (AhpC/Tsa family) [Campylobacter lari RM2100]
    MKELQIGDEAPIFELLNQDDVKISLKDFFGKKIILYFYPKDNTPGCTLEACDFTKFYDDFLNKNAVIIGISPDSVKSHVN
    FIQKHNLKHILLSDENKEICKLYGAWGLKKNYGKEYEGLIRSTFVIDENGKIEKIYKNVKTKDHAFKVLQELC

    >gi|222824404|ref|YP_002575978.1| thioredoxin reductase [Campylobacter lari RM2100]
    MMLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGTPGGQITSSSEIENYPGVAQVLDGISFMAPWNEQCMRFGLKHEMI
    GVEQISKNTDGSFNIKLENGKVEQAKAVIVCTGSTPRRAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEE
    ALYLANICSKVYLIHRRDEFRAAPSTVEKVRNNDKIELITNAVVDEVCGDNMGVNKVKIAFNDGSKRELDVPGIFTFVGL
    NVRNEILKQENGEFLCAMEEGGQVSVDLKMQTNIAGLFAAGDLRKDAPKQVICAAGDGAVAALSALAYIENLH

    >gi|222824405|ref|YP_002575979.1| thioredoxin [Campylobacter lari RM2100]
    MGKYIDLTAENFAQAKEGVALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTEEQGDLAAQFGVRSIPTIFFFKD
    GEVVDQLVGAQSKQVLADKLNSLL

    >gi|222823812|ref|YP_002575386.1| conserved hypothetical lipoprotein [Campylobacter lari RM2100]
    MFKTILTLSFLSIFFTACSNEEKLDANLISSGTQFSKENLQKANDLDKKSYEEIANLFKDNTNIKSDDKNILIIFSANHC
    LYCDKLKEEIKNDKKIQDFIKEKYSSYYINISYKKIHTFYKNHKSDLSTAELSSIYDIVATPTIVILNKNSQTLLNYPGF
    ISAKRLSATMEFLNQKENQNLDEAAIAQKLIHFYKENNI