Campylobacter jejuni RM1221 uid57899

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|57237154|ref|YP_178166.1| thioredoxin-disulfide reductase [Campylobacter jejuni RM1221]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMTPWNEQCMRFGLKHEMVG
    VEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDKFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    LYLANICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN
    VRNEILKQDDGKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESLH

    >gi|57237155|ref|YP_178167.1| thioredoxin [Campylobacter jejuni RM1221]
    MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN
    GEVVDQLVGAQSKQAISDKLNSLL

    >gi|57237327|ref|YP_178340.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni RM1221]
    MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSANYDKFGGKNAVIIGISPDSVASHEKF
    ISKFDLKHILLSDSEKEVAKAYGAWGLKKNYGKEYEGLIRSTFVIDEIGRIAQIYSNVRVKDHALKVLESL

    >gi|57237385|ref|YP_178398.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni RM1221]
    MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFS
    HFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTML
    FTNEHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL

    >gi|57238278|ref|YP_178641.1| hypothetical protein CJE0626 [Campylobacter jejuni RM1221]
    MIENIPASLWTKQDLNAYQIFDVRTPLEWEEGILPNAQCVALYDNQGLLNAKFLDEFQSKRDESKKLAFICRSGHRSMVA
    AEFIAEKLGLESINLDGGMLALKGY

    >gi|57238241|ref|YP_178678.1| pyridine nucleotide-disulphide oxidoreductase family protein [Campylobacter jejuni RM1221]
    MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQFYKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIET
    FQNALKEHNIEVEFGSEVESVKNENGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLANEKI
    LVVGGGNSAVEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEAGNSGKVELKLGIDINEVEDDNGKAKVNFTDGTSDI
    YDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVKGIFVAGDITTKNGASIVTGLNDAVKILSVL

    >gi|57238201|ref|YP_178718.1| thiol:disulfide interchange protein DsbD [Campylobacter jejuni RM1221]
    MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKDIYLYSNKLKLYINEKDISSLINLPQSSTRGNENVY
    YQKLNLALPNLLLERFAKNTTNLIKLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKAQKTDKKTKIESEESSIAN
    FLATDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFMSLAYAIAGVIASFLGASI
    QGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIHKKSEKGKGVVGIAIMGFLSALIVGPCVAAPLAGALIYIA
    NTGNALLGGSALFIMSFGMGIPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFSV
    FMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKHALSYDYINNFEQLKQEIQTNTKPIM
    LDFTASW
    CENCKLLDELTFSDERIIQKMQNYKLIKVDVSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADD
    LLKKIEP

    >gi|57236950|ref|YP_178751.1| methionine sulfoxide reductase A [Campylobacter jejuni RM1221]
    MKNIILGGGCFWCIEAVFERLKGVINTEVGYSGGKPNPSYESVCNGDGNIEVVKINYDEKQISLLEILILFFKIHDPTSI
    DKQGEDIGIQYRSIIFYENEEDKILAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQGYCQAVIAPKLQ
    KIQSD

    >gi|57237019|ref|YP_178821.1| hypothetical protein CJE0817 [Campylobacter jejuni RM1221]
    MKFYGIKNCNSVKKAIDALTQKGIVFDFMDIKKINQDILYTWLKQKSFEELINTAGLTSKKLGLNKEKVKNLNEKELEKI
    VLENPSCIKRPIIEYEQNIYIGKEYEKML

    >gi|57237624|ref|YP_178872.1| thiol peroxidase [Campylobacter jejuni RM1221]
    MSTVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKTQIILSVPSLDTPVCATEAREFNKKVASYNGAEVIV
    VSMDLPFAMGRFCSTEGIENLSVASDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLD
    AFFGGSSCCGGCGCH

    >gi|57237677|ref|YP_178925.1| methylated-DNA--protein-cysteine S-methyltransferase [Campylobacter jejuni RM1221]
    MFKVYYKMPLCYLSLHSDGKFLTRVDFCDNKRSEKKCSLLDLAKYELDLYFTHKLRKFSIPVLIQGTDFESKVYKALMEI
    PYGKIATYKDIAEKINYPKAFRAVGNANSKNQIPIFIP
    CHRVIASNGIGGYNGGLEIKRFLLENEGVNLK

    >gi|57237705|ref|YP_178953.1| thiol:disulfide interchange protein DsbA [Campylobacter jejuni RM1221]
    MKFPVKLARSIVVCAFLAGISASALSEGKEYVILKNPIANADNSLIEIFSYHCTHCYDHHKFNTMGKVKEKLPNLTYKFY
    PVSSMGDYGRQANEIFAFATFKDGVNKIDPTDKNSLTHKVAEAYFNAYFKKKQRWENGKNPEAFYSVGLKAMNVSKADFE
    NFLKTPEAAELLKSYEIANPISQNYGTPAFVVNGKYQIVPSAINSPEALIEITKELSKQK

    >gi|57237706|ref|YP_178954.1| putative disulfide oxidoreductase [Campylobacter jejuni RM1221]
    MKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRFDMLVMAIGGMIALINPANNIIKIFS
    YSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDG
    CREIPIYPFNLPLYKWAPSWFLPTGECGMDTPVVPENAYNHLNA
    FQKFFIGTPPDFENGLYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVLVLKFI
    GESKNPNQNIASLNQVVLRYS

    >gi|57237707|ref|YP_178955.1| thiol:disulfide interchange protein DsbA, putative [Campylobacter jejuni RM1221]
    MKILFNQGYNMRKFFCKFVLTLVFCSSFALANNSFITLNPSLPSSENSVIEAFSYKCIHCYNHHKFGTLEKLREAFPNLH
    FKLYPVSLMNGEFSKEMNELFAFAQYKDEQNGKDASYSDSLSYKLADVYFVSYFLNKQRNLSNLDEFYDIGLKAMNVNKN
    EVLNFLNTPKAKEILSEFQRANDIAKTYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK

    >gi|57237739|ref|YP_178987.1| SCO1/SenC family protein [Campylobacter jejuni RM1221]
    MKKNIILFIVIVAIILGVIFFIKNHQNSYDFILKSDLKEETTLKDFKGDKLIIYFGYTYCPDVCPATLSLVGKALKQINN
    PKAHLLFISLDPNRDNNLSNTNEWLRYFYPKADALIAKDEKTLQKITKQYNVQYQKIDLNDSFMGYSIAHSNMLYLIDEK
    GHFYKEISDLNPQEILRELRIFLNSQ

    >gi|57237988|ref|YP_179237.1| thioredoxin domain-containing protein [Campylobacter jejuni RM1221]
    MKKISALFLISLAFFLNACSKEEEIQNDFMFEEYHKGDKIVLNSVNGGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTP
    CKEEALDLSKLWKNNSSKFIIIGLTHFEDVSDETVKKFADDYGAYYFLSNDSSNDRIIAQILKDIDYQNMEQLPFKVVLK
    NGIYQKISDYWNNNTPTNFYLGKIPTELMQEDLNKIYKGK

    >gi|57237994|ref|YP_179243.1| methionine sulfoxide reductase B [Campylobacter jejuni RM1221]
    MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDDEIKGAVKRIPDKDGIRTEI
    VCANCNGHLGHVFEGEGFSAKNVRH
    CVNSISLEFVKTKD

    >gi|57238030|ref|YP_179279.1| heavy metal translocating P-type ATPase [Campylobacter jejuni RM1221]
    MKCEHCKLDYKQAQMIEYKGKFFCCKGCKSVWEILHESGLDEFYEKLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEIYL
    MIHGIE
    CAACVWLNEKILTKQEGILELDINHLNHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREF
    YSKLVVAIACVMNIMWIAVAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISGAS
    LAYVYSLWAMFFRVGEVYFDSVAMIICFVFIGKYLEMFSKKCALDTIDGLNDFLQNEVLVFNGKEFVSKEVQKVCLGDRI
    LLKTGDKILIDGICKSGEMSMDTSSLNGESIPKLIQKEDEIFSACIVLDGSVEYEATKLYKDSKLSQIIQLLELASSKKA
    KLESLVNSLLAYFSRTVLLIAFICFAFWFFYKEESFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFKSS
    SVIEDLSKCDCVVFDKTGILTKIELELKEVFLDKALDLNELYNFVKLSKHPISQNIVLYLKQKGAKDLNLDFKKHSSIQA
    KGLSAELNEGLLLGGSSKFLQEKGIVAKEFDNTHFIFAKEGKILAFFEFDSVLREGAKELIAYLKKEKKELMILSGDHQK
    AVEKIAKKLEIQNYQASCLPEDKMKTIENLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDLLS
    LKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSIIVVLNALRIKE

    >gi|57238033|ref|YP_179282.1| copper-translocating P-type ATPase [Campylobacter jejuni RM1221]
    MEELRIKIGKMTCVNCSNAIERACKKIDGVKDASVSYVNSSGVFLLEDQEKRKDIIAKIQNLGFEILEDEQSLNAYKAKK
    HLELRKNLLLSIVLSVIIMYFEMFVKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGLKSKNLDMNTLVALGTLSAFVYSF
    LVYLQIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESIKEISSSFVKSGDVLLVKE
    GESIVADGIVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGAVVLNGALRIKANKKAMDSTLEQIKNLVFEAGSIKSPLAN
    LADQISKYFVGGIIFFAFLVFVFWVLKADLNTAFLHSCAVLLISCPCALGLATPIALVVASANAAKNFILIKNPAALEKL
    ALVKYAFFDKTGTLTKEKLSVFKHNLSKDDFDKLCQIESLSSHPIAKALHKDQICDLKGEGRVIVGSGIKYKEDNDNYLV
    GSAQFLHENEIDTKESDIFFDSFKEYVRVYFAKNKKCLGGVLLSNALKDGAKELVLNLKEQNLKTFILSGDHVKNVEKIA
    KELQIDEFHAQLKSEEKLQIIQKFKKTLFVGDGINDAAALSAASVSMSFSKANELAKKTGDFILIKDDLSAIFKCFKLAK
    KTRGIIKLNLFWAFIYNVLCIPIAAGFIPFISLSPHIAALAMCFSSITVVLNSLRLKRI

    >gi|57238079|ref|YP_179328.1| putative lipoprotein [Campylobacter jejuni RM1221]
    MKIKKILLLVAISCLFVACSNDKEKQQNDVNLSTEASINQSDDMNFKLNLIDGGSISVKKENTVLNFNDEDKATLFVFFT
    TW
    CTPCIAEIPHLNKLQEKYNNDFNIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLAKALGGVNGIPTMFLYNKH
    SKLINQYLGLIPEEMLEIDIQKAIL

    >gi|57238423|ref|YP_179554.1| hypothetical protein CJE1571 [Campylobacter jejuni RM1221]
    MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVELNGQKQENILFTKDSLITPD
    LIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPE
    CPYCREHLAQIDNELKNYQVNY
    ILTPVHGKSAFEKSALIYKEAKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK

    >gi|57238523|ref|YP_179654.1| putative inner membrane protein [Campylobacter jejuni RM1221]
    MNSFKQKYLINFWDNSRSMIALGILSAVYFGIFGGVWAVTGEMTRWGGEFLELLGMNLDGYSYYQKQNLNGTPLTRTDGI
    MLIGMFIGCLVAALLANKVKFRLPASNIRIFQAIVGGILSGYGARLAFG
    CNLANFFTGLPYFSLHTWLFTVFMVLGIYLG
    VKICNTSFFKPKAKLERVNKENLPLNKQSLRTKLYFNLGILLFIAFLVWVFYLVFTNGNISTQNKQSLLALALIFGFVFG
    FVISRGQICFTSCFRDLFLFGRDNAIKGALIGMIIASLIAFAFILQGHTSKLIELSPAVAVGAFLFGFGIVFAGG
    CECGW
    TYRAFEGQSHFIIVGIANIIGTMILALSYDFLPKAFKEGIKINLLTEFGNLNGFFINLILFILMFVFVVFYKKHFFKNQL
    KG

    >gi|57238527|ref|YP_179658.1| selenide, water dikinase [Campylobacter jejuni RM1221]
    MQYKNQNLTHFVKAAGCAAKLSPGGLKTILNFMQKTPALLSDIGNNEDASVYQISRDLALVQTLDFITPIVDSAYHFGAI
    AAANALSDVFAMGAEVINALNIVGFDTCNHDVNILKELLEGANDKVQECNALVVGGHTIESTELFFGLSVTGKVHPSKFI
    ANNTSKIGDCIILTKPLGTGILSTALKAQMLNQKHLDIMLKNMMELNYKASQIALKFHPSAMSDVTGFGLLGHLKEMLNK
    NISFEIFQNEILFLEGAKEYFNMGLIPAGAYKNLEFIKELIPDLNEEKLLLCDPQTSGGLLISISEKESLECLKKLEDEN
    IQAKIIAKVVNKQENDIIIS

    >gi|57238675|ref|YP_179806.1| thiredoxin,-like protein [Campylobacter jejuni RM1221]
    MKKSLLILSILFLLNACSFENSKDTGKVGEKSAEISAKDTLGKAVKLADDNTSLKVLVFFQNGCPSCLKELPSLDEFIQN
    HPNKISVYAINSIDNANVVKVLAEQFDFKNVKVLKDDLKITNDRYAVFATPTTIIIKDGMIKDRILGEKPWEFFESKLIS
    LL