Campylobacter jejuni NCTC 11168 uid57587

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218561827|ref|YP_002343606.1| thioredoxin reductase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVG
    VEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    LYLANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKDGSIRDLNVPGIFTFVGLN
    VRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESLH

    >gi|218561828|ref|YP_002343607.1| thioredoxin [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELSNDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN
    GEVVDQLVGAQSKQAISDKLNSLL

    >gi|218561934|ref|YP_002343713.1| bacterioferritin comigratory protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSANYDKFGGKNAVIIGISPDSVASHEKF
    ISKFDLKHILLSDSEKEVAKAYGALGLKKNYGKEYEGLIRSTFVIDETGKIAQIYSNVRVKDHALKVLESL

    >gi|218561993|ref|YP_002343772.1| alkyl hydroperoxide reductase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFS
    HFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTML
    FTNEHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL

    >gi|218562172|ref|YP_002343951.1| putative rhodanese-like domain protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MIENISASLWTKQDLNAYQIFDVRTPLEWEEGILPNAQCVALYDNQGLLNAKFLDEFQSKRDESKKLAFICRSGHRSMVA
    AEFIAEKLGLESINLDGGMLALKGC

    >gi|218562211|ref|YP_002343990.1| putative pyridine nucleotide-disulphide oxidoreductase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQFYKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIET
    FQNALKEHNIEVEFGSEVESVKNENGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLGNEKI
    LVVGGGNSAAEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEAGNSGKVELKLGIDINEVEDDNGKAKVNFTDGTSDI
    YDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVKGIFVAGDIATKNGASIVTGLNDAVKILSVL

    >gi|218562254|ref|YP_002344033.1| putative thiol:disulphide interchange protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKDIYLYSNKLKLYINEKDISSLINLPQSSTRGNENVY
    YQKLNLALPNLLLERFAKNTTNLIKLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKAQKTDKKTKIESEESSIAN
    FLATDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFMSLAYAIAGVIASFLGASI
    QGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIHKKSEKGKGVVGIAIMGFLSALIVGPCVAAPLAGALIYIA
    NTGNALLGGSALFIMSFGMGIPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFSV
    FMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKHALSYDYINNFEQLKQEIQTNTKPIM
    LDFTASW
    CENCKLLDELTFSDERIIQKMQNYKLIKVDVSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADD
    LLKKIEP

    >gi|218562287|ref|YP_002344066.1| methionine sulfoxide reductase A [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKNIVLGGGCFWCVEAVFERLKGVINTEVGYSGGKPNPSYESVCNGDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSI
    DKQGGDIGIQYRSIIFYENEEDKILAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQGYCQAVIAPKLQ
    KIQSD

    >gi|218562356|ref|YP_002344135.1| putative ArsC family protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKLYGIKNCNSVKKAMDALTQKGIVFDFMDIKKINQDILYTWLKQKSFEELINTAGLTSKKLGLNKEKVKNLNEKELEKI
    VLENPSCIKRPIIEYEQNIYIGKEYEKML

    >gi|218562407|ref|YP_002344186.1| thiol peroxidase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MSIVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKTQIILSVPSLDTPVCATEAREFNKKVASYNGAEVIV
    VSMDLPFAMGRFCSTEGIENLSVASDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLD
    AFFGGSSCCGGCGCH

    >gi|218562464|ref|YP_002344243.1| methylated-DNA--protein-cysteine methyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MFKVYYKMPLCYLSLHSDGKFLTRVDFCDNKRSEKNCSLLDLAKYELDLYFTHKLRKFSIPVLIQGTDFESKVYKALMEI
    PYGKIATYKDIAEKINHPKAFRAVGNANSKNQIPIFIP
    CHRVIASNGIGGYNGGLEIKRFLLENEGVNLK

    >gi|218562493|ref|YP_002344272.1| putative disulfide oxidoreductase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MSCIKMKDKCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRFDMLVMAIGGMIALINPANNI
    IKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDG
    CREIPIYPFNLPLYKWASSWFLPTGECGMDTPVVPENAY
    NHLNAFQKFFIGTPPDFENGLYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVL
    VLKFIGESKNPNQNIASLNQVVLRYS

    >gi|218562494|ref|YP_002344273.1| putative protein disulphide isomerase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MRNFFCKFVLALVFYSSFALANNSFITLNPSLPSSENSVIEAFSYKCIHCYNHHKFGTLEKLREAFPNLHFKLYPVSLMN
    GEFSKEMNELFTFAQYKDEQNGKDASYSDSLSHKLADVYFVSYFLNKQRNFSNLDEFYDIGLKAMNVNKNEVLNFLNTPK
    AKEILSEFQRANDIAKTYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK

    >gi|218562530|ref|YP_002344309.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKKNIILFIVIVAIILGVIFFIKNHQNSYDFILKSDLKEETTLKDFKGDKLIIYFGYTYCPDVCPATLSLVGKALKQINN
    PKAHLLFISLDPNRDNNLSNTNEWLRYFYPKADALIAKDEKTLQKITKQYNVQYQKIDLNDSFMGYSIAHSNMLYLIDEK
    GHFYKEINDLNPQEILRELRIFLNSQ

    >gi|218562720|ref|YP_002344499.1| putative periplasmic thioredoxin [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKKISALFLISLAFFLNACSKEEEIQNDFMFEEYHKGDKIVLNSVNGGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTP
    CKEEALDLSKLWKNNSSKFIIIGLTHFEDVSDETVKKFAGDYGAYYFLSNGSSNDRIIAQILKDIDYQNMEQLPFKVVLK
    NGIYQKISDYWNNNTPTNFYLGKIPTELMQEDLNKIYKGK

    >gi|218562726|ref|YP_002344505.1| methionine sulfoxide reductase B [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDDEIKGAIKRIPDKDGIRTEI
    VCANCNGHLGHVFEGEGFSAKNVRH
    CVNSISLEFVKTKD

    >gi|218562767|ref|YP_002344546.1| putative cation-transporting ATPase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MIMKCEHCKLDYKQAQMIEYKGKFFCCKGCESVWEILHESGLDEFYEKLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEI
    YLMIHGIE
    CAACVWLNEKILTKQEGILELDINHLNHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKR
    EFYSKLVVAIACVMNIMWIAVAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISG
    ASLAYVYSLWAMFFRVGEVYFDSVAMIICFVFIGKYLEMFSKKRALDTIDGLNDFLQNEVLVFNGKEFVSKEVQKVCLGD
    RILLKTGDKILIDGICKSGEMSVDTSSLNGENTPKLIQKEDEIFSACIVLDGSVEYEATKFYKDSKLSQIIQLLELASSK
    KAKLESLVNSLLAYFSRTVLLIAFICFAFWFFYKEESFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFK
    SSSVIEDLSKCDCVVFDKTGILTKIELELKEVFLDKALDLNELYNFVKLSKHPISQNIVLYLKQKGAKDLNLDFKKHSSI
    QAKGLSAELNEGLLLGGSSKFLQEKGIVAKEFDNTHFIFAKEGKILAFFEFDSVLREGAKELIAYLKKEKKELMILSGDH
    QKAVEKIAKKLEIQNYQASCLPEDKMKTIENLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDL
    LSLKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSIIVVLNALRIKE

    >gi|218562773|ref|YP_002344552.1| putative cation-transporting ATPase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MEELRIKIGKMTCVNCSNAIERACKKIDGVKDASVSYVNSSGVFLLEDQKKRKDIIAKIKNLGFEILEDEQSLNAYKAKK
    HLELRKNLLLSIVLSVIIMYFEMFVKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGFKSKNLDMNTLVALGTLSAFVYSF
    LVYLQIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESIKEISSSFVKSGDVLLVKE
    GESIVADGVVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGAVVLNGALRIKANKKAMDSTLEQIKNLVFEAGSIKSPLAN
    LADQISKYFVGGIIFFAFLVFVFWVLKADLNTAFLHSCAVLLISCPCALGLATPIALVVASANAAKNFILIKNPAALEKL
    ALVKYAFFDKTGTLTKENLSIFKHNLSKDDFDKLCQIESLSSHPIAKALHKDHFFDLKGEGRVIVGSGIKYKEDNDNYLV
    GNAQFLHENEIDTKESDIFFDTFKEYVRVYFAKNKKCLGGVLLSNALKDGAKELVLNLKKQNLKTFILSGDHVKNVEKIA
    KELQIDEFHAQLKSEEKLQIIQKFKKTLFVGDGINDAAALSAASVSMSFSKANELAKKTGDFILIKDDLSAIFKCFKLAK
    KTRGIIKLNLFWAFIYNVLCIPIAAGFIPFISLSPHIAALAMCFSSITVVLNSLRLKRI

    >gi|218562819|ref|YP_002344598.1| putative lipoprotein thiredoxin [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKIKKILLLVAISCLFVACSNDKEKQQNDVNLSTEASINQSDDMNFKLNLIDGGSISVKKENAVLNFNDEDKVTLFVFFT
    TW
    CTPCIAEIPHLNKLQEKYNNDFNIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLAKALGGVNGIPTMFLYNKH
    SKLINQYLGLIPEEMLEIDIQKAIL

    >gi|218562989|ref|YP_002344768.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKKLSLILVCSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVELNGQKQENILFTKDSLITPD
    LIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPE
    CPYCREHLAQIDDELKNYQVNY
    ILTPVHGKSAFEKSALIYKEAKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK

    >gi|218563043|ref|YP_002344822.1| UDP-galactopyranose mutase [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MYDYLIVGSGLFGSIFAYEATEKGYTCLVVEQREHIGGNCYTENIKNINVHKYGAHIFRTSDQNIWDYMNQFCEFNHFIN
    SPIAIYKDEIYNLPFNMNTFSKLWGIKTPNEARKIIEMQKQIIQHPPKNLEEQAISLVGTDVYEKLIKGYTEKQWGRSCK
    DLPASIIRRLPVRYIYDNNYFNDPYQGIPKGGYTAIFDKMLKKSKVILNTDFLKYKDKFKNKAKKIVFTGCIDAYYDYRY
    GALEYRSLKFEHKILNLDNFQGVAVVNYTDKEIPYTRIIEHKHFEFGNTDTTVISEEYPLEWIKGIEPYYPINDEKNQAL
    YEKYKQLAKHESNVYFGGRLGEYRYYDMQDVVRSALLFCKNELKNKQG

    >gi|218563100|ref|YP_002344879.1| putative inner membrane protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MNSFKQKYLINFWDNSRSMIALGILSAVYFGIFGGVWAVTGEMTRWGGEFLELLGMNLDGYSYYQKQNLNGTPLTRTDGI
    MLIGMFIGCLVAALLANKVKFRLPASNIRIFQAIVGGILSGYGARLAFG
    CNLANFFTGLPYFSLHTWLFTVFMVLGIYLG
    VKICNTSFFKPKAKLERVNKENLPLNKQSLRTKLYFNLGILLFIAFLVWVFYLVFTNGNISTQNKQSLLALALIFGFVFG
    FVISRGQICFTSCFRDLFLFGRDNAIKGALIGMIIASLIAFAFILQGHTSKLIELSPAVAVGAFLFGFGIVFAGG
    CECGW
    TYRAFEGQSHFIIVGIANIIGTMILALSYNFLPKAFKEGIKINLLTEFGNLNGFFINLILFILMFVFVVFYKKHFFKNQL
    KG

    >gi|218563252|ref|YP_002345032.1| putative periplasmic thiredoxin [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MKKSLLILSILFLLNACSFENSKDTGKVGEKSAEISAKDTLGKAVKLADDNTSLKVLVFFQNGCPSCLKELPSLDEFIQN
    HPNKISVYAINSIDNANVVKVLAEQFDFKNVKVLKDDLKITNDRYAVFATPTTIIIKDGMIKDRILGEKPWEFFESKLIS
    LL

    >gi|218563253|ref|YP_002345033.1| putative lipoprotein thiredoxin [Campylobacter jejuni subsp. jejuni NCTC 11168]
    MGIFRIQAYFFALIIALFFVACDSGENFKALNSDKTYNFAYNGFEKSLKLNDKAQNFALVFFTKDCGVCKEQIPILQNLA
    KNYDFNIFVVLGDANDANDAKAWADEKGLSNLAMFYEKRAAKYLSSAIGEIYGVPVLSFFKEGKMDEKFIGLTPYSILEK
    EIKKVKS