Campylobacter jejuni doylei 269 97 uid58671

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|153951779|ref|YP_001397404.1| thioredoxin-disulfide reductase [Campylobacter jejuni subsp. doylei 269.97]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWNEQCMRFGLKHEMVG
    VEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKRAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    LYLANICSKVYLIHRRDEFRAAPFTVEKVKKNKKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN
    VRNEILKQDDGKFLCNMEEGGQVSVDLKMQTNVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESLH

    >gi|153951052|ref|YP_001397405.1| thioredoxin [Campylobacter jejuni subsp. doylei 269.97]
    MGKYIELTSDNFDQAKEGIALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN
    GEVVDQLVGAQSKQAISDKLNSLL

    >gi|153951866|ref|YP_001397490.1| hypothetical protein JJD26997_0271 [Campylobacter jejuni subsp. doylei 269.97]
    MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVELNGQKQENILFTKDSLITPD
    LINLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPE
    CPYCREHLAQIDDELKNYQVNY
    ILTPVHGKSAFEKSALIYKKAKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK

    >gi|153951302|ref|YP_001397700.1| putative lipoprotein [Campylobacter jejuni subsp. doylei 269.97]
    MKIKKILLLVAISCLFVACSNDKEKQQNDVNLSTEASINQSDDMNFKLNLIDGESISVKKENAVLNFNDEDKATLFVFFT
    TW
    CTPCIAEIPHLNKLQEKYNNDFNIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLVKALGGVNGIPTMFLYNKH
    SKLINQYLGLIPEEMLEIDIQKAIL

    >gi|153951001|ref|YP_001397739.1| copper-translocating P-type ATPase [Campylobacter jejuni subsp. doylei 269.97]
    MEELRIKIGKMTCVNCSNAIERACKKIDGVKDASVSYVNSSGVFLLEDQEKRKDIIAKIKNLGFEILEDEQSLNAYKAKK
    HLELRKNLLLSIVLSVIIMYFEMFVKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGLKSKNLDMNTLVALGTLSAFVYSF
    LVYLQIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESIKEISSSFVKSGDVLLVKE
    GESIVADGVVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGGVVLNGALRIKANKKAIDSTLEQIKNLVFEAGNIKSPLAN
    LADQISKYFVGGIIFFAFLVFIFWVVKADLNTAFLHACAALLISCPCALGLATPVALVVASANAAKNFILIKNPAALEKL
    ALVKYAFFDKTGTLTKENLSIFKHNLSKDDFDKLCQIESLSSHPIAKALHKDQIFDLKGEGRVIVGSGIKYKEDSDIYLA
    GSAQFLHENEIDTKESDIFFDTFKEYIRVYFAKNKKCLGGVLLSNALKDGAKELVLNLKKQNLKTFILSGDHVKNVEKIV
    KELQIDEFYAQLKSEEKLHIIQKFEKTLFVGDGINDAAALSAASVSMSFSKANELAKKTGDFILIKDDLSAIFKCFKLAK
    KTRSIIKLNLFWAFIYNVLCIPVAAGFIPFITLSPHIAAFAMCFSSITVVLNSLLIFKF

    >gi|153951967|ref|YP_001397742.1| heavy metal translocating P-type ATPase [Campylobacter jejuni subsp. doylei 269.97]
    MKCEHCRLDYKQVQMIEYKGKFFCCKGCESVWEILHESGLDEFYEKLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEIYL
    MIHGIE
    CAACVWLNEKILTKQEGILELDINHLNHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREF
    YSKLVVAIACVMNIMWIAVAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISGAS
    LAYVYSLWAMFFRVGEVYFDSVAMIVCFVFIGKYLEMFSKKCALDTIDGLNDFLRNEVLVFNGKEFTPKEVQKVCLGDRI
    LLKTGDKILIDGVCKSGEMSVDTSSLNGESIPKLIQKEDEIFSACIVLDGSVEYEATKLYKDSKLSQIIGLLELASSKKA
    KLESLVNSLSAYFSRTVLLIAFICFAFWFFYKEASFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFKSS
    SVIEDLSKCDYVVFDKTGILTKIELELKEVFLDKMLDLNEFYNFVKLSKHPISQNIASYLKQKGAKDLNLDFKKHSSIQA
    KGLSAELNKGLLLGGSSKFLQEKGIATKEFDNTHFIFAKEGKILAFFEFDSVLREGVKELIAYLKKEKKELMILSGDHQK
    AVEKIAKKLEIQNYQAFCLPEDKMKTIENLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDLLS
    LKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSTIVVLNALRIKE

    >gi|153951037|ref|YP_001397776.1| methionine sulfoxide reductase B [Campylobacter jejuni subsp. doylei 269.97]
    MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDDEIKGAIKRIPDKDGIRTEI
    ICANCNGHLGHVFEGEGFSAKNVRH
    CVNSISLEFVKTKD

    >gi|153951545|ref|YP_001397781.1| thioredoxin domain-containing protein [Campylobacter jejuni subsp. doylei 269.97]
    MKKILALFLISLAFFLNACSKEKEIQNDFMFEEYHKGDKIVLNSVNDGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTP
    CKEEALDLSKLWKNNSSKFIIMGLTHFEDVSDETVKKFADDYGAYYFLSNGSSNDRIIAQILKDIDYQNMEQLPFKVVLK
    NGIYQKISDYWNNNAPTNFYLGKIPTELMQEDLNKIYKGK

    >gi|153951451|ref|YP_001397860.1| UDP-galactopyranose mutase [Campylobacter jejuni subsp. doylei 269.97]
    MYDYLIIGAGLFGSIFAYEASKRGKKCLVLERREHIGGNCYTKEMAGINVHYYGAHIFRTNEKRIWDYMQQFCEFNHFIN
    SPIANYKGEIYNLPFNMNTFSKLWGISTPSEAREIIEKQKASIKGEPRNLEEQAISLVGVDVYEKFIKGYTQKQWGKACK
    DLPKSIIRRIPVRFVYDNNYFNDPYQGIPKGGYTKIFEKLLGQCEILLNIDFIERREEFAQKAKTIIFTGTIDSYFDYKL
    GALEYRSLKFEHEILDMQNYQGVAVVNYTDFETPYTRIIEHKHFEFGTQEKTVISREFPLSWSKDIEPYYPINDAKNTAL
    YESYLALAKAEKNVHFCGRLGEYRYYDMQDVVKSALKFCESELKD

    >gi|153951267|ref|YP_001398019.1| SCO1/SenC family protein [Campylobacter jejuni subsp. doylei 269.97]
    MKKNILFIVIVAIILGVIFFLKNHQNSYDFILKSDLKEETTLKDFKGDKLIIYFGYTYCPDVCPATLSLVGKALKQINNP
    KAHILFISLDPNRDNNLSNTNEWLRYFYPKADALIAKDEKTLQKITKQYNVQYQKIDLNDSFMGYSIAHSNMLYLIDEKG
    HFYKEISDLNPQEILRELRIFLNSQ

    >gi|153951196|ref|YP_001398047.1| hypothetical protein JJD26997_0933 [Campylobacter jejuni subsp. doylei 269.97]
    MKIFSKIILSSLALASLLHAQTLIEQQEESLVKGVIPSTKIAKVERSQIDGFYKAYLDNGNILYVNPFKRIIFIGELYTN
    TGASLTANDRDAWQSEVSTKQAKDLSLKEVTQYAKKVDFGKGSKKYEFVLFTDPE
    CPFCARVEELFIKKDVSVYVNFFPL
    SIHSHAEQWSKEILSAPDFKEALIKLRETQKDLEVKITPQAEQTLKKMRELGEKLNIMGTPKLLVVDKKERKIIDVIDGA
    NMQKINSYLDKDKQ

    >gi|153951189|ref|YP_001398077.1| putative thioredoxin [Campylobacter jejuni subsp. doylei 269.97]
    MIKKIKILFLVIFLAFSPMALEAKIYDDVYVAQKQALKEAKLMIFFVVSNTCEYCHKLMNDVSNNKDLMEYLNKNFIVAI
    SDLNANGLIPKDLLLNGVTPTTYILTPTGKVIGTPIEGAVDSDILFGLLKGLEDYKKGQLGF

    >gi|153952386|ref|YP_001398095.1| methylated-DNA--protein-cysteine S-methyltransferase [Campylobacter jejuni subsp. doylei 269.97]
    MFKVYYKIPLCYLSLHSDGKFLTGVDFCDNKRSEKNCSLLDLAKYELDLYFTHKLKKFSVPVLVQGTDFESKVYKALMKI
    PYGKIATYKDIAEKINHPKAFRAVGNANSKNQIPIFIP
    CHRVIASNGIGGYNGGLEIKRFLLENEGVNLK

    >gi|153951481|ref|YP_001398121.1| thiol:disulfide interchange protein DsbA [Campylobacter jejuni subsp. doylei 269.97]
    MKFPVKLARSIVVCAFLAGISASVLSEGKEYVVLKNPIANADNSLIEIFSYRCTYCYDHHKFNTMGKVKEKLPNLTYKFY
    PVSSMRDYGKQANEIFAFAAFKDGVNKIDPTDKNSLTHKVAEAYFNAYFKKKQRWENGKNPEAFYSVGLKAMDVSKADLE
    NFLKTPEAAEFLKSYKIANPISQNYGTPAFIVNGKYQIISSAINSPETLIEITKELSKQK

    >gi|153950974|ref|YP_001398122.1| putative disulfide oxidoreductase [Campylobacter jejuni subsp. doylei 269.97]
    MKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRFDMLVMAIGGMIALINPANNIIKIFS
    YSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDG
    CREIPIYPFNLPLHEWAPSWFLPTGECGMDTPVVPENAYNHLNA
    FQKFFIGTPPDFENGLYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVLVLKFI
    GEPKNPNQNIASLNQVVLRYS

    >gi|153952502|ref|YP_001398123.1| putative thiol:disulfide interchange protein DsbA [Campylobacter jejuni subsp. doylei 269.97]
    MKILFNQGYNMRNFFCKFVLALVFCSSFALANNSFITLNPSLPNSENSVIEAFSYKCIHCYNHHKFGTLEKLREAFPNLH
    FKLYPVSLMNGEFSKEMNELFAFAQYKDEQNGKDASYSDSLSHKLADVYFVSYFLNKQRNFSNLDEFYDIGLKAMNVNKN
    EVLNFLNTPKAKEILSEFQRANDIAKIYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK

    >gi|153951854|ref|YP_001398159.1| thiol:disulfide interchange protein DsbD [Campylobacter jejuni subsp. doylei 269.97]
    MRIFGIILLSICLCFASILSLNEAFNVKSNSYNNSISIDIELGKDIYLYSNKIKLYINEKDISSLINLPQSSTRGNENVY
    YRKLNLALPNLLLERFAKNNTNLIKLEFQGCSEQGLCYNPQTWYFDLISKKNTFEISKPYKAQKTDKKTKIESEESSIAN
    FLTTDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIIAKSNAKFSKKYSFFLSFIYVFFMSLAYAIAGVIASFLGTSI
    QGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIHKKSEKGKGVVGIAIMGFLSALIVGPCVAAPLAGALIYIA
    NTGNALLGGSALFIMSFGMGIPLLFIGLGLGFIKPGFWMEKVKIFFSFVMLAMAIWILSRIIEENYILIAYGILGVFFSV
    FMGIFEKSFAIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISTSKPALSYDYINNFEQLKQEIQTSIKPIM
    LDFTASW
    CENCKLLDELTFSDERIIQKMQNYKLIKVDVSQNNNEQIKTMKEFNVFGPPVLILFENGKEKLKITGFISADD
    LLKKLEP

    >gi|153950948|ref|YP_001398294.1| thiol peroxidase [Campylobacter jejuni subsp. doylei 269.97]
    MSTVNFKGSPVKLKGNSVEVGVNAPKVSLKAKDLSVIEIGAAGKTQIILSVPSLDTPVCATEAREFNKKVASYNGAEVIV
    VSMDLPFAMGRFCSTEGIENLSVASDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLD
    AFFGGSSCCGGCGCH

    >gi|153951061|ref|YP_001398339.1| hypothetical protein JJD26997_1289 [Campylobacter jejuni subsp. doylei 269.97]
    MKLYGIKNCNSVKKAMDALTQKGIVFDFMDIKKINQDILYTWLKQKSFEELINTAGLTSKKLGLNKEKVKSLNEKELEKI
    VLENPSCIKRPIIEYEQNIYIGKEYEKML

    >gi|153951089|ref|YP_001398405.1| methionine sulfoxide reductase A [Campylobacter jejuni subsp. doylei 269.97]
    MKNIVLGGGCFWCVEAVFERLKGVIDTEVGYSGGNPNPSYESVCNGDGNIEVVKINYDEKQIPLLEILTLFFKIHDPTSI
    DKQGADIGIQYRSIIFYENEEDKILAQNFIEKQQKIFSKKIVTQISRLQTYYKAENYHQHYFMNHPDQGYCQAVIAPKLQ
    KIQSD

    >gi|153952435|ref|YP_001398449.1| hypothetical protein JJD26997_1412 [Campylobacter jejuni subsp. doylei 269.97]
    MIENIPASLWIKQDLSAYQIFDVRTPLEWEEGILPDVQCVALYDNQGLLNAKFLDEFQSKRDESKKLAFICRSGHRSMVA
    AEMVAEKLGLESINLDGGMLALKGY

    >gi|153951156|ref|YP_001398615.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. doylei 269.97]
    MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFS
    HFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTML
    FTNEHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL

    >gi|153951008|ref|YP_001398680.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. doylei 269.97]
    MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSLNYDKFGNKNAVIIGISPDSATSHEKF
    ISKFDLKHILLSDSEKEVAKAYGAWGLKKNYGKEYEGIIRSTFVIDETGKIARIYSNVRVKDHALKVLESL

    >gi|153951496|ref|YP_001398798.1| putative inner membrane protein [Campylobacter jejuni subsp. doylei 269.97]
    MNSFKQKYLINFWDNSRSMIALGILSAVYFGIFGGVWAVTGEMTRWGGEFLELLGMNLDGYSYYQKQNLNGTPLTRTDGI
    MLIGMFMGCLVAALLANKVKFRLPASNIRIFQAIVGGILSGYGARLAFG
    CNLANFFTGLPYFSLHTWLFTVFMILGIYLG
    VKICNTSFFKPKAKLERVDKENLPLNKQSLRTKLYFNLGILLFIAFLVWVFYLVFTNGNISTQNKQSLLALALIFGFVFG
    FVISRGQICFTSCFRDLFLFGRNNAIKGALLGMIIASLIAFAFILQGHTSKLIELSPAVAVGAFLFGFGIVLAGG
    CECGW
    TYRAFEGQSHFMIVGIANIIGTMILALSYDFLPKALKEGIKINLLTEFGNLNGFFINLVLFILMFAFVVFYKKHFFKNQL
    KG

    >gi|153952399|ref|YP_001398939.1| putative thiredoxin-like protein [Campylobacter jejuni subsp. doylei 269.97]
    MKKSLLILSILFLLNACSFENSKDTGKVGEKSAEISAKDTLGKAVKLADDNTSLKVLVFFQNGCPSCLKELPSLDEFIQN
    HPNKISVYAINSIDNANVIKVLAEQFDFKNVKVLKDDLKITNDRYAVFATPTTIIIKDGMIKDRILGEKPWEFFESKLIS
    LL

    >gi|153952356|ref|YP_001399001.1| inner membrane protein YeeE [Campylobacter jejuni subsp. doylei 269.97]
    MLSGIIVGLLLGFVLQRGRFCVVGAYRDVFLSKKFTIFIALFIVVALQSIGVWALHSLGYISIKSQEFYWLSTIIGGIVF
    GFGMVIAGG
    CATGTWYRAGEGLIGSIAALLFYAFSASAVKYGVILPLRDNLNTFKISDGTFYQSLGISPWILVLALSLVV
    GFFVIRELRKPRLKFARLKPRKQGISHILFEKSWHPFVTAVLVALIAILAWLLSSLSGRNHGLGITTPSANLVQYLSTGD
    VQFIDWGVFLVLGIALGSFLGAKLSGEFRFRLPDKKTLAYASIGGILMGVGASLAGG
    CTIGNGLVETSLFSYKGWVATVF
    FLIGAYIATFYTIILPTRKATQKI

    >gi|153952616|ref|YP_001398940.1| thioredoxin family protein [Campylobacter jejuni subsp. doylei 269.97]
    MGIFRIQAYFFTLIIALFFVACDSGENFKALNSDKTYNFAYNGFEKSLKLNDKAQNFALVFFTKDCGVCKEQIPILQNLA
    KNYDFNIFVVLGDANDANDAKTWADKKGLSNLAMFYEKRATKYLSSAIGEIYGVPVLSFFKEGKMDEKFIGLTPYSILEK
    EIKKVKS