Campylobacter jejuni 81 176 uid58503

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121612852|ref|YP_999753.1| hypothetical protein CJJ81176_0065 [Campylobacter jejuni subsp. jejuni 81-176]
    MLKKLILGFIILLFCACNDEKIDENILSKGTKTTEQYKQDANNLDLNSYKEIAEFFKDNQNIVFSDKPVLIIFSANNCVY
    CDKLKHEIQNDKEVQNILKNTYNSYYINTSYHKIHNYDNKKTSTEELSREFNIDATPTLVFFTPKHKTLLIYPGFMSAKR
    LALTMEILKDEKNQKLNEDELFKTLFLAYKEKNV

    >gi|121613636|ref|YP_999871.1| thioredoxin-disulfide reductase [Campylobacter jejuni subsp. jejuni 81-176]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWNEQCMRFGLKHEMVG
    VEQILKNSDGSFTIKLEGGKTELTKAVIVCTGSAPKRAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    LYLANICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN
    VRNEILKQDDGKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESLH

    >gi|121612861|ref|YP_999872.1| thioredoxin [Campylobacter jejuni subsp. jejuni 81-176]
    MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN
    GEVVDQLVGAQSKQAISDKLNSLL

    >gi|121612655|ref|YP_999986.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. jejuni 81-176]
    MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSANYDKFGGKNAVIIGISPDSVTSHEKF
    ISKFNLKHILLSDSEKEVAKAYRAWGLKKNYGKEYEGIIRSTFVIDETGKIAQIYSNVRVKDHALKVLESL

    >gi|121613748|ref|YP_001000044.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. jejuni 81-176]
    MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFS
    HFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTML
    FTNEHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL

    >gi|121613054|ref|YP_001000222.1| hypothetical protein CJJ81176_0547 [Campylobacter jejuni subsp. jejuni 81-176]
    MIENIPASLWTKQDLNAYQIFDVRTPLEWEEGVLPNAQCVALYDNQGLLNAKFLDEFQSKRDENKKLAFICRSGHRSMVA
    AEFIAEKLGLESINLDGGMLALKGY

    >gi|121612116|ref|YP_001000259.1| pyridine nucleotide-disulphide oxidoreductase family protein [Campylobacter jejuni subsp. jejuni 81-176]
    MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQFYKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIET
    FQNALKEHNIEVEFGSEVESVKNENGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLGNEKI
    LVVGGGNSAAEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEARNSGKVELKLGIDINEVEDDNGKAKVNFTDGTSDI
    YDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVKGIFVAGDIATKNGASIVTGLNDAVKILSVL

    >gi|121613317|ref|YP_001000304.1| thiol:disulfide interchange protein DsbD [Campylobacter jejuni subsp. jejuni 81-176]
    MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKDIYLYSNKLKLYINEKDISSLINLPQSSTRGNENVY
    YQKLNLALPNLLLEHFAKNTTNLIKLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKTQKTDKKTKIESEESSIAN
    FLATDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFMSLAYAIAGVIASFLGASI
    QGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIHKKSEKGKGVLGIAIMGFLSALIVGPCVAAPLAGALIYIA
    NTGNALLGGSALFIMSFGMGIPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFSV
    FMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKSALSYDYINNFEQLKQEIQTNTKPIM
    LDFTASW
    CENCKLLDELTFSDERIIQKMQNYKLIKVDVSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADD
    LLKKLEP

    >gi|121612764|ref|YP_001000338.1| methionine sulfoxide reductase A [Campylobacter jejuni subsp. jejuni 81-176]
    MKNIVLGGGCFWCVEAVFERLKGVIDTEVGYSGGNPNPSYESVCNGDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSI
    DKQGGDIGIQYRSIIFYENEEDKILAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPNQGYCQAVIAPKLQ
    KIQSD

    >gi|121612619|ref|YP_001000413.1| hypothetical protein CJJ81176_0740 [Campylobacter jejuni subsp. jejuni 81-176]
    MKLYGIKNCNSVKKAMDALTQKGIVFDFMDIKKINQDILYTWLKQKSFEELINTAGLTSKKLGLNKEKVKNLNEKELEKI
    VLENPSCIKRPIIEYEQNIYIGKEYEKML

    >gi|121613237|ref|YP_001000468.1| thiol peroxidase [Campylobacter jejuni subsp. jejuni 81-176]
    MSTVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKTQIILSVPSLDTPVCATEAREFNKKVASYNGAEVIV
    VSMDLPFAMGRFCSTEGIENLSVASDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLD
    AFFGGSSCCGGCGCH

    >gi|121613265|ref|YP_001000521.1| methylated-DNA--protein-cysteine S-methyltransferase [Campylobacter jejuni subsp. jejuni 81-176]
    MFKVYYKMPLCYLSLHSDGKFLTRVDFCDNKRSEKNCSLLDLAKYELDLYFTHKLRKFSIPVLIQGADFESKVYKALMKI
    PYGKMVTYKDIAQKINHPKAFRAVGNANSKNQIPIFIP
    CHRVIASNGIGGYNGGLEIKRFLLENEGVNLK

    >gi|121613617|ref|YP_001000548.1| thiol:disulfide interchange protein DsbA [Campylobacter jejuni subsp. jejuni 81-176]
    MKFPVKLARSIVVCAFLAGISASALSEGKEYVILKNPIANADNSLIEIFSYRCTHCYDHHKFNTMGKVKEKLPNLTYKFY
    PVSSMGDYGKQANEIFAFAAFKDGVNKADPTDKNSLTHKVAEAYFNAYFKKKQRWENGKNPEAFYSVGLKAMNVSKADFE
    NFLKTPEAAELLKSYEIANPISQNYGTPAFVVNGKYQIVPSAIKSPEALIEITKELSKQK

    >gi|121613190|ref|YP_001000549.1| putative disulfide oxidoreductase [Campylobacter jejuni subsp. jejuni 81-176]
    MKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMEPCEQCVYIRFDMLVMAIGGMIALINPTNNIIKIFS
    YSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDG
    CREIPIYPFNLPLHEWAPSWFLPIGECGMDTPVVPENAYNHLNA
    FQKFFIGTPPDFENGLYSNGWYLIPSLKFINMAICCLIAFLCCFIVLFAMFIAYVLDKNKPNAKIFALAIVILVLVLKFI
    GEPKNPNQNIASLNHLNQVVLRYS

    >gi|121613081|ref|YP_001000551.1| thiol:disulfide interchange protein DsbA, putative [Campylobacter jejuni subsp. jejuni 81-176]
    MKILFNQGYNMRKFFCKFVLALVFYSSFALANNSFITLNPSLPNSENSVIEAFSYKCIHCYNHHKFGTLEKLREAFPNLH
    FKLYPVSLMNGEFSKEMNELFAFAQYKDEQNGKDASYSDSLSHKLADVYFVSYFLNKQRNFSNLDEFYDIGLKAMNVNKN
    EVLNFLNTQKAKEILSEFQRANDIAKTYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK

    >gi|121613029|ref|YP_001000784.1| thioredoxin domain-containing protein [Campylobacter jejuni subsp. jejuni 81-176]
    MKKILTLFLISLAFFLNACSKEEEIQNDFMFEEYHKGDKIVLNSVNGGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTP
    CKEEALDLSKLWKNNSSKFIIIGLTHFEDVSDETVKKFADDYGAYYFLSNGGSNDRIIAQILKDIDYQNMEQLPFKVVLK
    NGIYQKISDYWNNNAPTNFYLGKIPTELMQEDLNKIYKGK

    >gi|121612353|ref|YP_001000790.1| methionine sulfoxide reductase B [Campylobacter jejuni subsp. jejuni 81-176]
    MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDDEIKGAIKRIPDKDGIRTEI
    VCANCNGHLGHVFEGEGFSAKNVRH
    CVNSISLEFVKTKD

    >gi|121613249|ref|YP_001000832.1| heavy metal translocating P-type ATPase [Campylobacter jejuni subsp. jejuni 81-176]
    MKCEHCKLDYKQAQMIEYKGKFFCCKGCESVWEILHESGLDEFYEKLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEIYL
    MIHGIE
    CAACVWLNEKILTKQEGILELDINHLNHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREF
    YSKLVVAIACVMNIMWIAVAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISGAS
    LAYIYSLWAMFFRVGEVYFDSVAMIICFVFIGKYLEMFSKKRALDTIDGLNDFLQNEVLVFDGKEFAPKEVQKVCLGDRI
    LLKTGDKILIDGICKSGEMSVDTSSLNGENIPKLIQKEDEIFSACIVLDGSVEYEATKLYKDSKLSQIIQLLELASSKKA
    KLESLVNSLSAYFSRTVLLIAFICFAFWFFYKEESFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFKSS
    SVIEDLSKCDCVVFDKTGILTKIELELKEVFLDKALDLNELYNFVKLSKHPISQNIASYLKQKGAKDLNLDFKKHSSIQA
    KGLSAELNEGLLLGGSSKFLQEKGIVAKEFDNTHFIFAKEGKILAFFEFDSVLREDAKELITYLKKEKKELMILSGDHQK
    AVEKIARKLEIQNYQASCLPEDKMKTIEKLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDLLS
    LKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSIIVVLNALRIKE

    >gi|121612387|ref|YP_001000836.1| copper-translocating P-type ATPase [Campylobacter jejuni subsp. jejuni 81-176]
    MEELRIKIGKMTCVNCSNAIERACRKIDGVKDASVSYVNSSGVFLLENQEKRKDIIAKIQNLGFEILEDEQSLNAYKAKK
    HLELRKNLLLSIVLSVIIMYFEMFVKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGLKSKNLDMNTLVALGTLSAFVYSF
    LVYLKIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESIKEISSSFVKSGDVLLVKE
    GESIVADGVVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGAVVLNGALRIKANKKAMDSTLEQIKNLVFEAGNIKSPLAN
    LADQISKYFVGGIIFFAFLVFVFWVLKADLNTAFLHSCAVLLISCPCALGLATPIALVVASANAAKNFILIKNPAALEKL
    ALVKYAFFDKTGTLTKENLNIFKHNLSKDDFDKLCQIESLSSHPVAKALHKDQIFDLKGEGRVIVGSGIKYKEDSDIYLA
    GSAKFLHENEIDTKESDVFFDTFKEYVRVYFAKNKKCLGGVLLSNALKDGAKELVLNLKKQNLKTFILSGDHVKNVEKIA
    KELQIDEFYAQLKSEEKLQIIQKFKKTLFVGDGINDAAALSAASVSMSFSKANELAKKTGDFILIKDDLSAIFKCFKLAK
    KTRSIIKLNLFWAFIYNVLCIPIAAGFVPFITLSPHIAALAMCFSSITVVFNSLRLKRI

    >gi|121612300|ref|YP_001000882.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81-176]
    MKIKKILLLVAISCLFVACSNDKEKQQNDVNLSTEASINQSDDMNFKLNLIDGGSISVKKENTVLNFNDEDKATLFVFFT
    TW
    CTPCIAEIPHLNKLQEKYNNDFNIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLAKALGGVNGIPTMFLYNKH
    SKLINQYLGLIPEEMLEIDIQKAIL

    >gi|121613150|ref|YP_001001038.1| hypothetical protein CJJ81176_1382 [Campylobacter jejuni subsp. jejuni 81-176]
    MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVELNGQKQENILFTKDSLITPD
    LIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPE
    CPYCREHLAQIDDELKNYQVNY
    ILTPVHGKSAFEKSALIYKEAKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK

    >gi|121613475|ref|YP_001001147.1| putative inner membrane protein [Campylobacter jejuni subsp. jejuni 81-176]
    MNSFKQKYLINFWDNPRSMIALGILSAVYFGIFGGVWAVTGEMTRWGGEFLELLGMNLDGYSYYQKQNLNGTPLTRTDGI
    MLIGMFIGCLVAALLANKVKFRLPASNIRIFQAIVGGILSGYGARLAFG
    CNLANFFTGLPYFSLHTWLFTVFMVLGIYLG
    VKICNTSFFKPKAKLERVNKENLPLNKQSLRTKLYFNLGILLFIAFLVWVFYLVFTNGNISTQNKQSLLALALIFGFVFG
    FVISRGQICFTSCFRDLFLFGRDNAIKGALIGMIIASLIAFAFILQGHTSKLIELSPAVAVGAFLFGFGIVFAGG
    CECGW
    TYRAFEGQSHFIIVGIANIIGTMILALSYDFLPKAFKEGIKINLLTEFGNLNGFFINLILFILMFVFVVFYKKHFFKNQL
    KG

    >gi|121613144|ref|YP_001001307.1| thiredoxin,-like protein [Campylobacter jejuni subsp. jejuni 81-176]
    MKKNLLILSILFLLNACSFENSKDTGKVGEKSAEISAKDTLGKAVKLADDNTSLKVLVFFQNGCPSCLKELPSLDEFIQN
    HPNKISVYAINSIDNANVVKVLAEQFDFKNVKVLKDDLKITNDRYAVFATPTTIIIKDGMIKDRILGEKPWEFFESKLIS
    LL