Actinobacillus pleuropneumoniae serovar 3 JL03 uid58891

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|165975511|ref|YP_001651104.1| glutaredoxin 1 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MFVEIYGRMTCPYCTRAKALAEKMKGELADFDFKFIDMIAEGISKEDLEPRVGKPVATVPQIFLDNVHVGGCTDFQALVK
    EKFGIEV

    >gi|165975530|ref|YP_001651123.1| glutaredoxin-like protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    METIDTIEKIKKQIGENPILLYMKGSPKFPSCGFSARAVEAVINCQVPFGYVDILTNPDIRAELPKFANWPTFPQLWVEG
    ELVGGCDIVLEMFQKGELQTLLKEVAAKHA

    >gi|165975536|ref|YP_001651129.1| rhodanese-related sulfur transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSETFTEISPHQAWELIENEGATLADIRDGRRYAYSHPQDAFHLTNESYGRFLDEVDYEEPVIVICYHGVSSRNTAQFLV
    EQGFDRVYSVKGGFDGWERSGLPIETAY

    >gi|165975541|ref|YP_001651134.1| thioredoxin reductase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MTVKHAKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTDEIENWPGEYEHTTGTGLMDKMLKHAEKFNTEIV
    FDHINSVDLSKRPFTLKGDINTFTCDALIIATGASAKYLGLPSEEAFKGKGVSA
    CATCDGFFYRNKPVAVVGGGNTAVEE
    ALYLANIASEVHLVHRRDSFRAEKILLGRLQKRVEEGKIILHTDRTVEEVLGDNMGVTGVRLASTKDESKEEIKVDGFFV
    AIGHAPNTAIFDGQLELDNGYIKVKSGLEGNATATSVAGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEA

    >gi|165975609|ref|YP_001651202.1| Na(+)-translocating NADH-quinone reductase subunit D [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MASNNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAIAVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIAS
    LVILVDQILRAYAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAMLIIVAFLRELIGSGKLF
    GVTILQTVQDGGWYQANGLFLLAPSAFFIIGFVIWGIRTWKPEQVEK

    >gi|165975610|ref|YP_001651203.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPANQLVYTHVLKDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVN
    CAIFGGVSFMVQREYNFTESVVYGLGAGTGWMLAIVALAGL
    TEKMKYSDVPAGLRGLGITFITVGLMALGFMSFSGIQL

    >gi|165975621|ref|YP_001651214.1| Na(+)-translocating NADH-quinone reductase subunit E [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYVLIPLEAQFLRTLVFILV
    IAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTN
    CAVLGVALLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAA
    ADVPRPFQGASIALITAGLMSLAFMGFTGLVKI

    >gi|165975622|ref|YP_001651215.1| electron transport complex protein RnfB [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MLAFPIIVYILIAIAVIALIFGAILGYSSIKLKVEADPIVEQIDALLPQSQCGQCGYPGCKPYAEAIANGDQITKCVPGG
    QPLVVKIADLLGVEVPAMDGVAEPEVKVALIHEDMCIGCTKCIQACPVDAIIGTNKAMHTVIPDLCTGCELCVAPCPTNC
    IEMVKQQTTTKTWNWQFDENLVIPVVNTTELQKKLVIGGGKNE

    >gi|165975627|ref|YP_001651220.1| electron transport complex RsxE subunit [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MNTENQIPVTEIDTTTPAEPSIWRNLLAEGVWKNNGALVQLLGLCPLLAVSNNVTNALGLGLATLLVLVCTNTMVSLFRK
    FTPTDIRIPIYVMVIATVVTAVQLLMNAFAYPVYQSLGIFIPLIVTN
    CIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLS
    LVTLGAMRELIGNGTLFDGLDLLLGDWAKSLRIDVLHLDSGLLLAILPPGAFIGLGVILAVKNLIDKK

    >gi|165975768|ref|YP_001651361.1| molybdopterin biosynthesis protein MoeB [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MELSDQEMLRYNRQIILKSVDFDGQEKLKASRVLIVGLGGLGCSAAQYLASAGVGHLILVDFDEVSLSNLQRQILHTDAN
    IGQPKVESAKVRLSQINPHIQLEAINKQCSDAEFAELIERVDLVVDCTDNVTVRNQLNLQCFAQKRPLVSGSAIRFEGQI
    SVFTYAENKPCYNCLSRLFGDGTLS
    CVEAGVIAPIVGVVGSLQALEAIKLLLNIGKSLSGKLLMIDGLYFSVREMNLPKL
    QDCEICCQ

    >gi|165975778|ref|YP_001651371.1| disulfide bond formation protein B [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MLSYFKELSLNRTAWLLLAFVAFALEASAIYFQYGMGLVPCVMCVYERLAIFGLLIAGLVGAISPRFFLTRWLALLLWGF
    SAFKGLALAIKHHDYQANPSPWNQ
    CEFKPEFPQTMPFDQWFPSIFAPGPVNCSEKQWEMFGLGMPEWLILAFSIFALMFV
    IVLLSQFKRAKPQYRSVFR

    >gi|165975893|ref|YP_001651486.1| methionine sulfoxide reductase B [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MIKDIDELTEEQVEILINHGTEMPYSGKFLNENRIGTYRCARCHNALFRSDTKFDAGCGWPSFYEAISDDALRYLDDYSL
    GRHRTEIRCGNCDSHMGHVFNDGPPPTGLRF
    CLNSIALIFKWDETGEEIDG

    >gi|165975917|ref|YP_001651510.1| thiol:disulfide interchange protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDSALPGFRTAISNEGVVQISENGRFVIQGQIFELKNG
    KAVNITNKSLLADLNALEKEMIIYPAKNEKHVVTVFMDIT
    CHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQME
    AIWTSADKVKALTDAENGTLPKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEPKELLKMLSE

    >gi|165975938|ref|YP_001651531.1| putative gamma-carboxymuconolactone decarboxylase subunit [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MFTNWKEQTQITKQAFGKMAQAHPKMLQAMGALNAASAEEGLDAKTRELIALAVAITTRCESCISVHAEAAIKAGATDKE
    IAGALATAIETNAGAAYAYALRAFEAVETQR

    >gi|165975953|ref|YP_001651546.1| putative thiamine biosynthesis protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MGVFPPYQHGCYACLFPDTEIGNLNCRTAGVLAPIVGIIGSLQALETLKFLLGLAVSCDGKFYVFDGRTLMWQ

    >gi|165976188|ref|YP_001651781.1| dihydrolipoamide dehydrogenase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKHAEKNGITFGEPN
    IDLDKVRAGKEAVVSKLTGGLAGMAKARKVTVVEGLATFTDPNTLVARDRDGNPTTIKFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVAIYTKQIEKKFKLMLETKVT
    AVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLIDAGKAGVNVDDRGFIAVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGQKHYFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKLI
    FDKDTHRLLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNAKAKKR

    >gi|165976265|ref|YP_001651858.1| thioredoxin-dependent thiol peroxidase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MNTLKAGEQAPQFTLLDQHEQPVSLSQFAGKKVLVYFYPKALTPGCTTQACGLRDSKSELEELNVVVLGISPDLPKKLAQ
    FVEKKALNFTLLSDADHQVAEAFGVWGEKKFMGRTYDGIHRISFLVNEQGVIEQVFDKFKTGEHHQMVVDFVKGTK

    >gi|165976348|ref|YP_001651941.1| iron-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MAITLTETAANRVRTFLENRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNEDDHVFEQHGVKVIVDEKSLTYLDGTELDFV
    KEGLNEGFKYNNPNVKDSCGCGESFNV

    >gi|165976353|ref|YP_001651946.1| methylated-DNA--protein-cysteine S-methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKSTIYYQYYDSPVGKLLLIANDKGLIGIEFEQEQLTSDAQKWQEANETSGQIFEIFCKTRDILDRYFAGEKLEFRHLDF
    LAPQGTEFQKSVWQILLTIPYGKTTSYGEIARQLGKPNAMRAVGGAVGRNPISIIVP
    CHRVLGKSQTLTGFGGGLPAKRY
    LLALEGIHFKDKGIEFVNPKHKKWDKA

    >gi|165976449|ref|YP_001652042.1| peptide methionine sulfoxide reductase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MANIREIYLAGGCFWGTEAFMQRINGVLDAQSGYANGNTENPSYQEVCAGSGHAEVVKVTYDADKISLAKLLDYYFKVID
    PVSVNQQGEDKGIQYRTGIYYVDPQDIPVINQALADLQTQYEQPLVVENTMLEHYFPAEEYHQDYLDKNPNGYCHIDLQL
    MNEILRNQ

    >gi|165976476|ref|YP_001652069.1| thiol:disulfide interchange protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKKTFLFLPLLLLIALVAFLTVPLMNKDALSPTEDWRDKPFPEFVGKNLLDHNAHINNNSLPKEPYILNVWASWCTWCIK
    EFPILLKLKEQGVPIVGLTYSDQPKDAREALARWGNPFDLVIDDYEKGFLIQTLKVSSAPSSYLIDKHGVVRYQQKGYNP
    DFEQDFLPRLKALQEEK

    >gi|165976496|ref|YP_001652089.1| putative macrophage infectivity potentiator-related protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSKFQIHTIETAPEAAQEALKAVKQANGFIPNLIGVLANAPTALETYRTVSGINGRNSLTPLEREVVQITAAIVNGCGFC
    VAGHTKIALKALNAPKEIVDQIRATARISDPKLDTLARFTLAVMLQKAKLTEAQLNEFFAAGYNQQSAIEVVLGVSLATL
    CNYANNIAETPINPELQDFA

    >gi|165976501|ref|YP_001652094.1| thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MTLQVTDATFEQEVLKSDVPVLLDFWAPWCGPCRMVAPILDELSEEFAGRAKIAKVNVDENQQIPAQFGIRSIPTLILFK
    NGEVVATQVGALPKSQLSAFVEQAL

    >gi|165976512|ref|YP_001652105.1| arsenate reductase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MEKVTIYHNPKCGTSRNTLALIRHLGIEPTIIHYLETPPDEVTLRNLISEIGIRVRDLLRTNVPPYETLNLSRMELSDDE
    LIAAMLAEPILINRPIVITSKGVRLCRPSEKFLEISPVSLDKPFIKEDGGVIEL

    >gi|165976644|ref|YP_001652237.1| putative uncharacterized protein involved inoxidation of intracellular sulfur [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MQKLLFIFNSAPYGNESFFSGLRLALQIQEQHKAQLKLFLMSDSVTAALRKHNPSEGYNLQQMLEILTAQGATIKLCKTC
    INARGMSALPLADGVEIGTLIELADWTMEADKVLNF

    >gi|165976645|ref|YP_001652238.1| flavoprotein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MQHFDVVIIGAGASGLFCAAQLGQAGKRVAVLDSGKKIGRKILMSGGGFCNFTNLEVTANHYLSQNKHFVKSALARYTNW
    DFIALVAQYGISYHEKELGQLFCDESSQQIVDLLQAECDKGKVEIFLRQAVIFVEKFAKNFQIQTASETFETEHLIIATG
    GLSMPALGASPFGYKIAEQFNIPVIPPRASLVPFTWKDSDKHFATLSGIALPIRATCGQQSFSNQMLFTHRGLSGPAILQ
    ISNYWDLGETVEIDLLPADDISTILTELRQSSPKLQLKTVLNRYLPKKLVELWLEQGVFKDNVIVQLSKAELARLDQLIH
    HWQFLPNGTEGYRTAEVTMGGVDTDFISSKTMQAKHTEGLYFIGEVLDVTGWLGGYNFQWAWSSAFACAEAIIEK

    >gi|165976662|ref|YP_001652255.1| glutathione reductase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MTKHYDYLAIGGGSGGIASINRAASYGKKCAIVEAKHLGGTCVNVGCVPKKVMFYGAHIAEAINSYAPDYGFDVTVNNFD
    FAKLIESREAYISRIHTSYNNVLAKNNVDVLNGFAKFVAAKTVEVTYADGSSEQVTADHILIATGGRPSIPAIKGAEYGI
    DSDGFFALREVPKRVAVVGAGYIAVEIAGVLNSLGSETHLFVRQHAPLRMQDPLIVDTLLEVLAQDGITLHTQAIPQEVR
    KNADGSLVLTLADGREATVDCLIWAIGREPACDKINLDAVGVKTNAKGQIIVDKFQNTNVPNVYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPNEHLDYNLVPTVIFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTAMYTAVTQHRQPCRMKLV
    CVGKDEKVVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|165976682|ref|YP_001652275.1| cation transport ATPase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSITLKLGGLHCGNCVKSVEKALNAVEGVTKATVTLDPQQAIVEGSASAEALIAAVDDIGFEAEVI

    >gi|165976683|ref|YP_001652276.1| copper-transporting P-type ATPase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MAKEQQLLIDGMHCAACVRRVEKILMKVEGVTFASVNLADQTAFVQGEADPQAMVQAVEKIGFGAEILESEQERRAKQQA
    QTQRTLSHKKWQFIMALIVGFGLVVLGLVIGMIPNSTNLMYWFIAAAVSLFTMYFAGKDFFIGAWVSLKNKASTMDTLVA
    LSTGVAWLYSFWLTLFPQPQAHVYYEASVMIIGFINLGKFLELKAKQRSSLALEKLLDLAPQQAVVFDRNNAAQTIPVKG
    IKPEMRVQALTGDRLAVDGRLESGSIWVDESMLTGEALPIEKKVGDKVRAGTLIQDGAGIYIAEQVGSQTALARVINAVR
    HAQSSKPPLAQFVDKVASVFVPVVVSIALISGLVWLFLGKDFSFALSIFTTVLIIACPCALGLAIPLSTIAGVARAAEFG
    VLVRNIEALQASSEIDTLVFDKTGTLTTGEMTVSDIQTFNGFEPNRVLQLAKSLEVHASHPIAKAIVKFAENQTACEVTN
    VQVVKGAGIVANLGEDQIKVGNAKFVNFSGNLTASRATQIFVAVNDQLAGILSVEDQLCDESKAVIEKFKAQGYQCLMLT
    GDRQATAEYFAQQLGLDGVIAEVSPEQKADKIRELQAQGKKVAMIGDGINDAPALAQANVGIAMHNGSDIAVETADLSLM
    QHGLAPVLQILPFAKRVLRNMKQSLLGAFMYNVIAIPLAAGVLYPFTGWLLNPMIAAIAMTMSSITVVLNSQRLLK

    >gi|165976703|ref|YP_001652296.1| putative gamma-carboxymuconolactone decarboxylase subunit [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MFQDWKAHTAHVKKSFGALGAKHPKMFEAYQALGAAAAAEALDHKTRELIALAVAVTTRCDSCISVHAEEAAKAGATESE
    IAGALATAIALNAGAAYTYSLRALEAVAVQDE

    >gi|165976704|ref|YP_001652297.1| rhodanese-related sulfurtransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MNKLTYLLGALVLATPVLTQAAEMKETEQTMQNAPLKAKGIWIDVRTADEFQQGHLDGSINIPFEQIADHISKVSPNKDE
    PVHLY
    CRSGRRAETALQTLKQLGYNNVTNHGGYQELIEKGYK

    >gi|165976784|ref|YP_001652377.1| thiol:disulfide interchange protein precursor [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MLTLSAHAGLFGNDQPKYLSGSEAFAFSATPKSDKQIELNWQIADGYYLYKKEIQVTPQNAEIQPLAFPAAENYHDEFFG
    EVEIFRNQLTLPITFSAEQANASLSVHYQGCTKGFCYPPETVTVSLDGQQAVDSAQNVAKNSENSTASQPLANAPKAEQD
    QLAENLANNRLSIFWFFLLGIGLAFTPCVLPMLPLLSAIVIGNKQRPNTFKALLLSFAYVQGMALTYTLLGLVVAALGLP
    FQVALQSPPVLISLAILFTILAASMFGLFEIRLPNSWQQKLNAMSQKQQGGAFGSVFVMGMIAGLVASPCTSAPLSGALL
    YVAQSGDLLTGGLALYLLALGMGIPLILITLFGNRILPKSGDWLLKVKTAFGFVMLALPVFLLSRILPSHYEPLMWSALA
    MVFVGWLISVIPTQGVIKQAVRIVLFLTFAVASYPWANLVWNQGNSSHSAQVSNHLAFERVQSLAELQEKLTASQGKKVM
    LDLYADW
    CVACKEFEKYTFTDQAVQQKLAEMVVLQVDMTNNSAQNDELMKHFNVLGLPTILFFDESGKELTQSRVTGFLE
    ANQFLNWLNQL

    >gi|165976887|ref|YP_001652480.1| iron-sulfur cluster insertion protein ErpA [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MNDIQIPIIFTDAAAKKVKSLIEGEDNPNLRLRVYITGGGCSGFQYGFTFDDQVNDGDLTIENQNVGLVVDPMSLQYLIG
    GTVDYTEGLDGSRFVVNNPNATSTCGCGSSFSI

    >gi|165976895|ref|YP_001652488.1| UDP-galactopyranose mutase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKYDYLIVGAGLFGSIFAREATKRGKKCLVIEKRDHIGGNCYTQNVEGINVHKYGAHIFHTSNKVVWDYIQQFAEFNRFT
    NSPVARYKDELYSLPFNMLTFNKMWGVITPQEAEAKIKEQIAKENITDPKNLEEQAISLVGRDIYEKLIKGYTEKQWGRK
    CTELPAFIIKRLPVRYTYDNNYFYDTYQGIPIGGYTGIFERMLEGIEVKLGVDFFAEREHYESLAEKIVFTGMIDEYFGY
    QFGKLEYRSLRFDNEVLNIPNYQGNAVVNYTEAEVPYTRIIEHKHFEYGTQPKTVITREHSKEYEEGDEPYYPINDARNN
    ELYAKYKALADATPNVIFGGRLAQYKYFDMHNIIAEALECVKVHF

    >gi|165976907|ref|YP_001652500.1| thioredoxin-like protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MQNKYAMLSRFGKNIFFYGLMFIVLSTVIDWYRKPSAPNQFAQQVLYDLQHQPKMIAQLSHDRPMLLYFWGSWCTYCKFT
    SPAIQQFADENVPVLSVALKSGTPQDVVDYLKQEDYRFPVINDPDGVISKSWDIQATPTVLIIKDGEIVQHTTGLTSYWG
    LKVRLWLSNLT

    >gi|165976910|ref|YP_001652503.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSLKDMTGQKVPNVTFHTRQGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHLPRYNELACEFKAAGVDDIICMSVN
    DTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPQEPGDPFKVSDADTM
    MKYLVQGWAPKESVSIITKPG
    CPFCAKAKALLKEKGYTFEEIVLGRDASTISVRAITGKTSVPQVFIGGKYIGGSDDLAA
    YFAK

    >gi|165976917|ref|YP_001652510.1| thiol peroxidase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSNVTLMGNPITVAGIFPQVGDTVADFSLVNNGLENVALASFAGKRKVLNIFPSIDTGVCATSVRVFNQKAADLSNTVVL
    CISADLPFAQARFCGAEGIENVQTLSTFRNKAAHNALGVDIQSGPLAGLTSRSVIVLDENNRVLHSELVSEIKNEPNYEA
    ALAVLA

    >gi|165976943|ref|YP_001652536.1| thiol:disulfide interchange protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MNKKLLLPLIIFLGLTVTFMVQLSRNAQGDDPKKLESALVGKTIPDFRLESLLDEKQMLDQNVLKTGTPRLLTVWATWCP
    T
    CYAEHEYLTLLAKQGVEIVGVDYKDERSKAMRFLASYGNPYKANIYDPKGSLGLDLGVYGAPETFIIDGNGVIHYRHAG
    DVNDQVWNQVLKPIYEKLKQ

    >gi|165976953|ref|YP_001652546.1| glutathione S-transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKLYCLKGACSFVPHVALEWTGAEYQAELVSRDFIKSAEFLALNPRGAVPLLVDGDLALSQNQAILHYLDEKYPDAKLFG
    SKTLRDKAKAARWLAFFNSDVHKSFVPLFRLPSYAEGNEELTRVIRQQAAEQVLSQLATANEHLESHIFFGENISVADVY
    LYIMLNWCRMLGLDFSHLEQLSPFMQRVEANAGVDAIRVAEGLKG

    >gi|165977074|ref|YP_001652667.1| thiol-disulfide isomerase and thioredoxin [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MLCEKLIKWVTFIFALVITCNAAATLPQAVEKIPKNVKNEPLFKDGKGYYSYKKPIDIELPKDGRVLIQYFFKYDCNICL
    NADDYLKQYARLHSDQVILQRSPVYDGNDIFTGQMHATFMQFGREDLSDLFLFDSAGRKESMSLVKSNDAIVQWLTSKGI
    DAQAFNRLFHSDEVKNRMKQAQTLFNKYKPPYVPIAVLNGKYILLQNTLYNDDYTYGVLDFLVNKLQQEQKEETK

    >gi|165977078|ref|YP_001652671.1| sulfur transfer complex subunit TusD [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MDYVLAVKSPVYGDQGAYLAYQVAESLLASEHNIKQVFFFQDGVGNANALVNPASDEINLVEKWQELTKLHDLPLHLCIS
    AAQRRGVVDNQTSKIQQSNLADGFILAGLGEFSQAVLKADRLLTF

    >gi|165977301|ref|YP_001652894.1| putative mercuric transport protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MSLSQKNSNNRFFASLTAALVAAVSSTLCCIAPLVYLVFGISSPWLVSLSEYEYLQLPLLFVSLGAFGYGFWLLMFSKKI
    ICTKYCSRRTLMILYWIAFAIILFFLSYPFILPWLLA

    >gi|165977312|ref|YP_001652905.1| thiol:disulfide interchange protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKKLALKSVLVALSTFFAVNSTAIAADPVEGKEYTQVRQAPSAQKEVVEFFSFYCPHCYDFELTYKIPSQIKQALPKDAK
    LVQYHVNFLGRQSENLTRAWALAMALGVEDKVKTALFEAAQKDAMKSMDDIKAVFTANGVSAADFDNGINSFAVNGLVNK
    QVQLAENFKIRGVPAFFVNGQYQINLEGFADSASTNEFVKRYVEAVTFLIKK

    >gi|165977319|ref|YP_001652912.1| hypothetical protein APJL_1918 [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MTIRVYGIKNCDTVKKALKWLTDNNISHQLHDYRIDGLSVDFLQHAEATFGWESLVNKRSTTWRNLDEAVKNNLDRATAL
    KVLQDQPTLIKRPIILQDGIALIGFDVKQYEQTFGK

    >gi|165977422|ref|YP_001653015.1| putative inner membrane protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MLEIWQQFKQTYLIKFWNPVPAVIAAGILSAYYFGLTGTYWAVTGEFTRWGGEILQLLGVDVSGWGYFNFISLDGTILNR
    IDGLMILGMFAGCIAAALWANNMKIRMPQNKIRILQALIGGALAGFGARLAMG
    CNLASLFTGIPQFSMHAWYFTLATAIG
    TYAGVKFTLLPMFRPPLKLKKGAGKVEASNPKQAQFRFWIGVAVFTAWTIASIYVLQYSIKLGFAMLFGLGFGLLIERAQ
    ICFTSAFRDLWVSGRSHMGKAIIYGMLIGTICVFSYIQLGMEPKIMWAGPNAIIGGLLFGFGIVLAGGCETGWMYRAMEG
    QVHFMWVGVGNVIGSTLLAYLWDDLAPVLALDYEKINLLKSFGPVSGLLINYALMIACLIFIVWWEKRFIRKAKVRVAAT
    NTYTIN

    >gi|165977492|ref|YP_001653085.1| rhodanese-related sulfur transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MKLKLSALAVALSLLAGCNEQKIGEISQTELLKQKDNPEFLIIDTRGDTFYNGFKSQQTARGGHIPNAIQFTAEWVEAIH
    PDYFESFASDKGITKDKTLVLYDDNLDNLEKVSAEFIAKGYKVKLFKDFVKYTQDPTAPLEAFPNYHWLVSAQWLKDALD
    GKKPETDSGKEIMVFHVSWGPLEQAQGYKQHVSGAYHFDTDWIENGPVWNLSAPDIVEKNLLKNGITKDKTVVLYSENQL
    AAFRVLWALKWAGVEDVRILNGGVNAWINNEYPIDTTTNIPTPETDFGTKIPANPQLTIETAQQAYAKQKEGVKLVSIRA
    WDEHLGKISGYDYIPGKGEPEGAIWGYAGTDSSNVADYYDPDGSLRNPKEIFALWEQQGIKPNDHLAFY
    CGTGWRAGIPW
    FMTQMAGWKNAVVYDGGWNAWQMDGSLPTKTHSTVTKPNAKNFFGVTPRSGLSCKS

    >gi|165976497|ref|YP_001652090.1| thiamine biosynthesis protein ThiI [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
    MRKRFIKILTSNIRNVLLRETENVAVIRNWDFIEVRAKVAEEAPIVLDLLKRTPGIHHILEVEEMPFTTMHDIFENTLAK
    VRDELEGKTFCVRVRRKGKHEFRSLDVEKYVGGGLNQHIESARVKLTKPDVTVRIDIDGDKMLLINARHEGLGGYPIGTQ
    EDVLSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGAAHEIGVKQMAYHIWSRYSTSHKVRFVAINFENVVGEILEKVDN
    GQMGVVLKRMMVRAASKIAERFDIQAIVTGEALGQVSSQTLTNLRLIDKASDTLVLRPLITHDKEQIIAMAKEIGTDDIA
    KSMPEFCGVISKNPTVKAIESKIVEEEGHFNFEVLEQAVANAQFLDIREIAQQTEQEVVSVETTSELTENDIILDIRSPE
    ETDEAPFSLDGIEVKLMPFYKLSSQFASLDQSKNYLLY
    CQRGVMSKLQALYLKENGFSNVKVFRH