Campylobacter jejuni 81116 uid58771

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157414353|ref|YP_001481609.1| hypothetical protein C8J_0031 [Campylobacter jejuni subsp. jejuni 81116]
    MLKKLILGFIILLFCACNDEKIDENILSKGTKTTEQYKQDANNLDLNSYKEIAEFFKDNQNIVFSDKPVLIIFSANNCVY
    CDKLKHEIQNDKEVQNILKNTYNSYYINTSYHKIHNYDNKKTSTEELSREFNIDATPTLVFFTPKHKTLLIYPGFMSAKR
    LALTMEILKDEKNQKLNEDELFKTLFLAYKEKNV

    >gi|157414463|ref|YP_001481719.1| thioredoxin-disulfide reductase [Campylobacter jejuni subsp. jejuni 81116]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGIAQVMDGISFMAPWNEQCMRFGLKHEMVG
    VEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKRAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    LYLANICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVTGVKVKLKDGSIRDLNVPGIFTFVGLN
    VRNEILKQDDGKFLCSMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESLH

    >gi|157414464|ref|YP_001481720.1| thioredoxin [Campylobacter jejuni subsp. jejuni 81116]
    MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELANDFDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKN
    GEVVDQLVGAQSKQAISDKLNSLL

    >gi|157414568|ref|YP_001481824.1| anti-oxidant AhpCTSA family protein [Campylobacter jejuni subsp. jejuni 81116]
    MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSANYDKFGGKNAVIIGISPDSVTSHEKF
    ISKFNLKHILLSDSEKEVAKAYRAWGLKKNYGKEYEGIIRSTFVIDETGKIAQIYSNVRVKDHALKVLESL

    >gi|157414631|ref|YP_001481887.1| antioxidant, AhpC/Tsa family [Campylobacter jejuni subsp. jejuni 81116]
    MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDFTFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFS
    HFAWKNTPVNQGGIGQVKFPLVADLTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTML
    FTNEHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL

    >gi|157414803|ref|YP_001482059.1| hypothetical protein C8J_0483 [Campylobacter jejuni subsp. jejuni 81116]
    MIENIPASLWTKQDLNAYQIFDVRTPLEWEEGILPNAQCVALYDNQGLLNAKFLDEFQSKRDESKKLAFICRSGHRSMVA
    AEFIAERLGLESINLDGGMLALKGY

    >gi|157414840|ref|YP_001482096.1| pyridine nucleotide-disulphide oxidoreductase family protein [Campylobacter jejuni subsp. jejuni 81116]
    MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQFYKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIET
    FQNALKEHNIEVEFGSEVESVKNENGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLANEKI
    LVVGGGNSAAEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEAGNSGKVELKLGIDINEVEDDNGKAKVNFTDGTSDI
    YDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVKGIFVAGDIATKNGASIVTGLNDAVKILSVL

    >gi|157414885|ref|YP_001482141.1| thiol:disulfide interchange protein DsbD [Campylobacter jejuni subsp. jejuni 81116]
    MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKDIYLYSNKLKLYINEKDISSLINLPQSSTRGNENVY
    YQKLNLALPNLLLEHFAKNTTNLIKLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKTQKTDKKTKIESEESSIAN
    FLATDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFMSLAYAIAGVIASFLGASI
    QGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIHKKSEKGKGVLGIAIMGFLSALIVGPCVAAPLAGALIYIA
    NTGNALLGGSALFIMSFGMGIPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFSV
    FMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKSALSYDYINNFEQLKQEIQTNTKPIM
    LDFTASW
    CENCKLLDELTFSDERIIQKMQNYKLIKVDVSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADD
    LLKKLEP

    >gi|157414916|ref|YP_001482172.1| methionine sulfoxide reductase A [Campylobacter jejuni subsp. jejuni 81116]
    MKNIVLGGGCFWCVEAVFERLKGVIDTEVGYSGGNPNPSYESVCNGDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSI
    DKQGGDIGIQYRSIIFYENEEDKILAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPNQGYCQAVIAPKLQ
    KIQSG

    >gi|157415004|ref|YP_001482260.1| hypothetical protein C8J_0684 [Campylobacter jejuni subsp. jejuni 81116]
    MKLYGIKNCNSVKKAMDALTQKGIVFDFMDIKKINQDILYTWLKQKSFEELINTAGLTSKKLGLNKEKVKNLNEKELEKI
    VLENPSCIKRPIIEYEQNIYIGKEYEKML

    >gi|157415050|ref|YP_001482306.1| thiol peroxidase [Campylobacter jejuni subsp. jejuni 81116]
    MSTVNFKGNPVKLKGNSVEVGADAPKVNLKAKDLSVIEIGAAGKTQIILSVPSLDTPVCATEAREFNKKVASYNGAEVIV
    VSMDLPFAMGRFCSTEGIENLSVASDFVAKEFGEKYGVLINEGALEGLLARAVFVIKEGKVAYKELVNEITEMPDIAKLD
    AFFGGSSCCGGCGCH

    >gi|157415103|ref|YP_001482359.1| methylated-DNA--protein-cysteine S-methyltransferase [Campylobacter jejuni subsp. jejuni 81116]
    MFKVYYKMPLCYLSLHSDGKFLTRVDFCDNKRSEKNCSLLDLVKYELDLYFTHKLRKFSIPVLIQGTDFESKVYKALMKI
    PYGKIATYKDIAEKINHPKAFRAVGNANSKNQIPIFIP
    CHRVIASNGIGGYNGGLEIKRFLLENEGVNLK

    >gi|157415131|ref|YP_001482387.1| thiol:disulfide interchange protein DsbA [Campylobacter jejuni subsp. jejuni 81116]
    MKFPVKLARSIVVCAFLAGISASALSEGKEYIILKNPIANADNSLIEIFSYRCTHCYDHHKFNTMGKVKEKLPNLTYKFY
    PVSSMGDYGRQANEIFAFAAFKDGVNKIDPTDKNSLTHKVAKAYFNAYFKKKQRWENGKNPEAFYSVGLKAMNVSKADLE
    NFLKTPEAAELLKSYEIANPISQNYGTPAFVVNGKYQIIPSAINSPEALIEITKELSKQK

    >gi|157415132|ref|YP_001482388.1| putative disulfide oxidoreductase [Campylobacter jejuni subsp. jejuni 81116]
    MKDNCRKFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMEPCEQCVYIRFDMLVMAIGGMIALINPTNNIIKIFS
    YSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVDG
    CREIPIYPFNLPLHEWAPSWFLPTGECGMDTPVVPENAYNHLNA
    FQKFFIGTPPDFENGLYSNGWYLIPSLKFMNMAICCLIAFLCCFIVLFAMFIAYVLDKNKLNAKIFALVIVILVLVLKFI
    GEPKNPNQNIASLNHLNQVV

    >gi|157415134|ref|YP_001482390.1| thiol:disulfide interchange protein DsbA, putative [Campylobacter jejuni subsp. jejuni 81116]
    MRKFFCKFVLTLVFCSSFALANNSFITLNPSLPNSENSVIEAFSYKCIHCYNHHKFGTLEKLREAFPNLHFKLYPVSLMN
    GEFSKEMNELFAFAQYKDEQNGKDASYSDSLSHKLADVYFVSYFLNKQRNFSNLDEFYDIGLKAMNVNKNEVLNFLNTPK
    AKEILSEFQRANDIAKTYGTPAFVVNGKYQINPSAINSMQDLEDLVKKLSNMK

    >gi|157415167|ref|YP_001482423.1| SCO1/SenC family protein [Campylobacter jejuni subsp. jejuni 81116]
    MKKNIILFIVIVAIILGVIFFIKNHQNSYDFILKSDLKEETTLKDFKGDKLIIYFGYTYCPDVCPATLSLAGKALKQINN
    PKAHLLFISLDPNRDNNLSNTNEWLRYFYPKADALIAKDEKTLQKITKQYNVQYQKIDLNDSFMGYSITHSNMLYLIDEK
    GHFYKEISDLNPQEILRELRIFLNSQ

    >gi|157415367|ref|YP_001482623.1| thioredoxin domain protein [Campylobacter jejuni subsp. jejuni 81116]
    MKKILTLFLISLAFFLNACSKEEEIQNDFMFEEYHKGDKIVLNSVNGGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTP
    CKEEALDLSKLWKNNSSKFIIIGLTHFEDVSDETVKKFADDYGAYYFLSNGGSNDRIIAQILKDIDYQNMEQLPFKVVLK
    NGIYQKISDYWNNNAPTNFYLGKIPTELMQEDLNKIYKGK

    >gi|157415373|ref|YP_001482629.1| methionine sulfoxide reductase B [Campylobacter jejuni subsp. jejuni 81116]
    MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDDEIKGAVKRIPDKDGIRTEI
    VCANCNGHLGHVFEGEGFSAKNVRH
    CVNSISLEFVKTKD

    >gi|157415421|ref|YP_001482677.1| heavy metal translocating P-type ATPase [Campylobacter jejuni subsp. jejuni 81116]
    MKCEHCKLDYKQAQMIEYKGKFFCCKGCESVWEILHESGLDEFYEKLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEIYL
    MIHGIE
    CAACVWLNEKILTKQEGILELDINHLSHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREF
    YSKLVVAIACVMNIMWIAVAKYAGLFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISGAS
    LAYVYSLWAMFFRVGEVYFDSVAMIICFVFIGKYLEMFSKKRALDTIDGLNDFLQNEVLVFNGKEFAPKKVQKVCLGDRI
    LLKTGDKILIDGICKSGEMSVDTSSLNGESIPKLIQKEDEIFSACMVLDGSVEYEATKLYKDSKLSQIIQLLELASSKKA
    KLESLVNSLSAYFSRTVLLIAFICFAFWFFYKEESFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFKSS
    SVIEDLSKCDCVVFDKTGILTKIELELKEVFLDKVLDLNELYNFVKLSKHPISQNIASYLKQKGAKDLNLNFKKHSSIQA
    KGLSAELNEELLLGGSSKFLQEKSIATKEFDNTHFIFAKEGKILAFFEFDSVLREGAKELIAYLKKEKKELMILSGDHQK
    AVEKIARKLEIQNYQASCLPEDKMKAIENLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDLLS
    LKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSIIVVLNALRIKE

    >gi|157415425|ref|YP_001482681.1| copper-translocating P-type ATPase [Campylobacter jejuni subsp. jejuni 81116]
    MEELRIKIGKMTCVNCSNAIERACKKIDGVKDASVSYVNSSGVFLLEDQEKRKDIIAKIKNLGFEILEDEQSLNAYKVKK
    HLELRKNLLLSIVLSVIIMYFEMFVKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGLKSKNLDMNTLVALGTLSAFVYSF
    LVYLQIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESIKEISSSFVKSGDVLLVKE
    GESIVADGVVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGAVVLNGTLRIKANKKAMDSTLEQIKNLVFEAGNIKSPLAN
    LADQISKYFVGGIIFFAFLVFVFWALKADLNTAFLHACAVLLISCPCALGLATPIALVVASSNAAKNFILIKNPAALEKL
    ALVKYAFFDKTGTLTKENLSIFKHNLSKDDFDKLCQIESLSSHPIAKALHKDQIFDLKGEGRVIVGSGIKYKEDSDIYLA
    GSAKFLHENEIDTKESDIFFDTFKEYVRVYFAKNKKCLGGVLLSNALKDGAKELVLNLKKQNLKTFILSGDHVKNVEKIA
    KELQIDEFYAQLKSEEKLRIIQKFKKTLFVGDGINDAAALSAATVSMSFSKANELAKKTGDFILIKDDLSAIFKCFKLAK
    KTRSIIKLNLFWAFIYNVLCIPIAAGFVPFITLSPHIAALAMCFSSITVVLNSLRLKRI

    >gi|157415470|ref|YP_001482726.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81116]
    MKIKKILLLVAISCLFVACGNDKEKQQNDVNLSTEASINQSDDMNFKLNLIDGGSISVKKENAVLNFNDEDKATLFVFFT
    TW
    CTPCIAEIPHLNKLQEKYNNDFNIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLAKALGGVNGIPTMFLYNKH
    SKLINQYLGLIPEEMLEIDIQKAIL

    >gi|157415617|ref|YP_001482873.1| hypothetical protein C8J_1298 [Campylobacter jejuni subsp. jejuni 81116]
    MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVELNGQKQENILFTKDSLITPD
    LIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPE
    CPYCREHLAQIDDELKNYQVNY
    ILTPVHGKSAFEKSALIYKEAKKAKNDKEKIAILNKYYDANIKNYPKVSDTELKEVFSLYEKYRSLGLSATPTIIK

    >gi|157415723|ref|YP_001482979.1| putative inner membrane protein [Campylobacter jejuni subsp. jejuni 81116]
    MNSFKQKYLINFWDNSRSMIALGILSAVYFGIFGGVWAVTGEMTRWGGEFLELLGMNLDGYSYYQKQNLNGTPLTRTDGI
    MLIGMFIGCLVAALLANKVKFRLPASNIRIFQAIVGGILSGYGARLAFG
    CNLANFFTGLPYFSLHTWLFTVFMVLGIYLG
    VKICNTSFFKPKAKLERVNKENLPLNKQSLRTKLYFNLGILLFIAFLVWVFYLVFTNGNISTQNKQSLLALALIFGFVFG
    FVISRGQICFTSCFRDLFLFGRDNAIKGALIGMIIASLIAFAFILQGHTSKLIELSPAVAVGAFLFGFGIVFAGG
    CECGW
    AYRAFEGQSHFMIVGIANIIGTMILALSYDFLPKAFKEGIKINLLTEFGNLNGFFINLILFILIFAFVVFYKKYFFKNQL
    KGSTVKITYSLNLQGEACPYPAIATLDVLPKLQSGEILEVLCDCPQSINSIPQDAKNRGFKVLEIDQSGPTLRFLIQKP

    >gi|157415884|ref|YP_001483140.1| periplasmic thioredoxin [Campylobacter jejuni subsp. jejuni 81116]
    MLNACSFENSKDTGKVGEKSAEISAKDTLGKAVKLADDNTSLKVLVFFQNGCPSCLKELPSLDEFIQNHPNKISVYAINS
    IDNANVVKVLAEQFDFKNVKVLKDDLKITNDRYAVFATPTTIIIKDGMIKDRILGEKPWEFFESKLISLL

    >gi|157415885|ref|YP_001483141.1| thioredoxin family protein [Campylobacter jejuni subsp. jejuni 81116]
    MGIFRIQAYFFALIIALFFVACDSGENFKALNSDKTYNFAYNGFEKSLKLNDKAQNFALVFFTKDCGVCKEQIPILQNLA
    KNYDFNIFVVLGDANDANDAKAWADEKGLSNLAMFYEKRAAKYLSSAIGEIYGVPVLSFFKEGKMDEKFIGLTPYSILEK
    EIKKVKS