Campylobacter hominis ATCC BAA 381 uid58981

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|154147931|ref|YP_001405821.1| thioredoxin-disulfide reductase [Campylobacter hominis ATCC BAA-381]
    MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEMGMPGGQITSSSEIENYPGVADKMDGISFMSAWQEQCFRFGLKHEMIK
    VKRVAKKQNGEFEIFLENGKSELAKAVIVATGSAPRKAGIKGEDEFFGKGVST
    CATCDGFFYKGKEVAVVGGGDTALEES
    LYLANICSKVYLIHRRDSFRAVPSTTEKVKKNKKIELITNSVVNEIKGDNSGVCEIVIKNKNGEIRNLKVPGIFTFIGLD
    VRNDILKDENGEFICEMNENGQVVVNLKMQTNVPGLFAAGDIRQDAPKQVVCSAGDGAIAALSAINYIENQH

    >gi|154149269|ref|YP_001405822.1| thioredoxin [Campylobacter hominis ATCC BAA-381]
    MGKYIELTSANFDAETSKGAVLVDFWAPWCGPCRMLSPVIEELAEDFEGKAKICKVNTDEAQDLATKFGVRSIPTLLFIK
    DGEIKAQMIGAQSKQVIADKINSLL

    >gi|154148262|ref|YP_001405938.1| hypothetical protein CHAB381_0336 [Campylobacter hominis ATCC BAA-381]
    MRLFRKKEKEEKGCTCGGNCEPVNNKEVKETSCCDLNYSSENIEKVEEKKKEKGIKILGSGCSKCAALEKSTREALAELN
    VEEYIDHITDFSQIASYGVMSTPALVINGKVVSYGKVLNKDEVKDLLKQNGIN

    >gi|154149390|ref|YP_001406040.1| redoxin superfamily protein [Campylobacter hominis ATCC BAA-381]
    MKKLIILSIFLTIFSGCQNENHHMSINDPVGIDTVYESGKLKIKGQNSPFVVFFFSATCGACSEQVPSLIELGKKFKNVK
    FIGIMGNSQGFDKDMKILKEKGVDFLTISSPKSVDYFSNAVGGIYGVPATFLFDKDGKIVKKYIGLTSKNIIEKDIKSLL


    >gi|154147936|ref|YP_001406107.1| bacterioferritin comigratory protein [Campylobacter hominis ATCC BAA-381]
    MGEILEADKERKITLNVDDEAPLFCLKNGEDDDVCLKDFIGKKVVLYFYPKDNTPGCTIEACEFSANFDEFIAQNAVIIG
    VSPDSVKSHANFAAKQSLKHILLSDSDHEVSKLYGVWQVKKNYGREYLGVVRSTFVIDENGKICKIYKNVRAKDHAAKVL
    ADLAK

    >gi|154148941|ref|YP_001406541.1| thiol:disulfide interchange protein DsbD (protein-disulfide reductase) (disulfide reductase) [Campylobacter hominis ATCC BAA-381]
    MDFKILESILFKILLSLLSFFTFCFAAPIQPFKAFVVDSTIQNEKIYFDFKIAEDIYVYKNSFKIHFVKNSLLLNENAKF
    PDSKIYKNNEIFAGEFFITLPENIAKSDKFSIALDFIGCSASGFCYPPQTRSFSYEKKDGNYKIVSLNQKDLKNASFNEQ
    TAIADDIKNKNFILTLLSFFGYGILLSFTPCIFPMVPILSSVIVAKTSKNAGKGAFLVSLIYVLGISLAYAVTGFLASFF
    GASLQSILQMPAVILGLCAVFVFLAFSMFGFYEIRLPSRLQTFFTQKGDKSSGYFGIFVMGIFSALIVGPCVAAPLAGAL
    LYITQSGDIFLGTSALFFLGFGSGIPLLLLGISAKFLPHPGAWMNLITRIFGFLLLIMAIWLGTRVWGENFSLLLYGILG
    VSFAVFFGIFDFRVHKIRRVISLLALIYSVFLLVGFFSGAVSALKPFENFTTAKISGRNELQFTEISTLDDLENFVQNTK
    KPVMVDFWASW
    CENCKLLEKDTFKDRKVYEILQNFDLVKIDVSRNGDEDLKLMQKFNVFGPPALIFYKNGKELKDLQITG
    FIDVKNFMEILDEI

    >gi|154149007|ref|YP_001406571.1| 2-cys peroxiredoxin BAS1 [Campylobacter hominis ATCC BAA-381]
    MLVTKKAPNFTATAVLGDNKIVDDFNLYKNLGPKGAVVFFYPKDFTFVCPSEIIAFDHRYQDFKDRGIEVIGISTDNEFS
    HLAWKNTPINKGGIGQIKYPLVADITKDIARSFDVLYANAVALRGSFLLDKDGTVRHMVLNDDALGRNIDEMLRMVDTML
    FTNENGVVCPAGWNKGKEAMKANPQGVADYLGKNADKL

    >gi|154148997|ref|YP_001406643.1| peptide methionine sulfoxide reductase MsrA/msrB [Campylobacter hominis ATCC BAA-381]
    MKILKLLIFFLFFVTANGENMQNLNEIYLAGGCFWGMQGYFDKVEGINKTEVGYANGNTDKTSYYEVSKTGHAETLHIIF
    DTNKIDLAEILERFFSIIDPFSLNRQGNDKGTQYRTGVYFNDKKTGKKVKKFFENKQKKFKEKFAIEIVPLRNFIVAEEY
    HQKYLQKNPDGYCHIDLTKANKPLYEQNFRKPGNAEIKNLDEISYQVTQNAATEKPFSSELDKNFKPGIYVDIVSGEPLF
    SSKDKFDAGCGWPSFSKPITTDVMNYFNDTSHSMIRTEVRSKLANSHLGHVFDDGIKEKGGLRY
    CINGASLKFIPLEKMN
    ELGYGDFLPYME

    >gi|154149539|ref|YP_001406644.1| hypothetical protein CHAB381_1086 [Campylobacter hominis ATCC BAA-381]
    MKKIIFVSAALAISLNAATNEEILGLYSGAPKDIKIEITDRKAVDGLDGFEAVVLKMSQGDMSQEDIAFTKDNLFIPDLV
    NVKTGMSYKDQIRQTRVYSLLADVYPKEEAKNIIKLGNDAKKPTLVVFTDAE
    CPYCRKEMEKAEDRLKTHNLEIVMTSVH
    GESGNVKSALIYKETAKAKSDDEKLKVLHKYYNMTEKGDKSKVSDAEFKAAEDLAKKYQSNGINGVPFIVEKDKISK

    >gi|154149241|ref|YP_001406668.1| thioredoxin domain-containing protein [Campylobacter hominis ATCC BAA-381]
    MKKILGILISAMIFLGGCDERNDTISSEQNFAPYEVGEQISLKSVSGDEITIKRTNEGFKLANSDKLLMFDIFATYCEPC
    KAEAAHLTDLINKNKENMAFIGLITFEEIENHEIIENFMKKYGAYYFIANEKENDRLIAQILNDIKYNHALSIPFKVLLQ
    NGKYVNLTDFNEGMRFKKYYLGAVPEGVIENDLQRLK

    >gi|154148126|ref|YP_001406672.1| copper-translocating P-type ATPase [Campylobacter hominis ATCC BAA-381]
    MAKLKCDHCKLGFDESAMIHCEDGHKFCCNGCKQVFYLLQENGLEEFYTRLGKNTLNPAKTREISKNETEAIYENFVRQN
    ADGFNEIFIIIEGIH
    CSACVWLNEKVLFNSKGVIEANINATTNKAKIVWDENETNLAEIFSKIKSIGYEPYPYDPNRSET
    RINSKRREFYAKLIVGIFSVMNIMWIAVALYGGYFSGMDAATKDILHFGEFILATPVLFYTGSVFFKGAFFAIKNRTPNM
    DLLIATGSGIVYIYSVYAMLARNGEVYFDSVAMIITFVFIGKYLEILSKKRATDKLDNFSNTIIGAVLVKNEKGGFINKK
    ADEISIGDEILLNEGAKVLIDGCVISGNASFDYASINGESVPVSVQAGDEIKSGAICMQGSVVYRASANFKNSLLSKIID
    LLENAPLKKPQIERMANEISGIFSIVILTLAALTFFIWLYFGSFDKALITAVSVIIIACPCALGLATPVATLVGLGAGLK
    EKILFKEAKTIENIAKCDTIVFDKTGTLTNGKLKVNKSKFLIDFDISLLDSLLKASNHPISKAVNEFLNFKGENLKISNI
    RNFPAKGISANFGNIKISGGSAKFMRELGIKNVEHLDTSEYFFAINGKLAAIFELSDSIKNDAKSSVSELEKLGFEIFML
    SGDNENAVKKIANEIGIKNYESGVLPDKKAKFVQNLSKRNKFVIMVGDGVNDAPALSLANVGICLGSGADISMEKSDVVL
    LTDDLTSLVCAIKIAKKSFKKVKENLIFSLCYNAITIPLACLGFIIPLYAAISMSFSSLIVVLNSLRLKNFRR

    >gi|154148113|ref|YP_001406870.1| oxidoreductase [Campylobacter hominis ATCC BAA-381]
    MINVYDLAVVGGGPCGIASVVEAKKQGIKTVLLLEKGDNHSQTIRQFYKDKKRVDKEYKGLNSHTIGNVGFETGTKESVL
    NYFDELLDSEEFDSFFKMEVEKVEKLNDGPFCITTVNSGFRANNVIIAIGRMNKPNKPDYKIPPSIVQRVNFNLDK
    CGIN
    EKVLIVGGGNAAAEYALSLCKTNIVTLCYRKPKFTRLNEINEKAIMHETRYGNIILRLDTDIKELENENGKVLVKFKCGM
    ELVYDRVIYAIGGTSPINFLKTCNIKLDEKGIPIVNENCATNINGLYVGGDLITRNGGSIVVAINHAHMIIKDILKK

    >gi|154149088|ref|YP_001406878.1| thiredoxin [Campylobacter hominis ATCC BAA-381]
    MKKSVWIITFLLFTFGIFYFFKSEPKTASKTPLIEQNATLSTDYTKPFRLNLTDKNFIKMQKTKSGFSIENNATMTIFAF
    FASW
    CEACRVQNEILNSIAAKYTSNVQVIGVLINDDIDKNATYAFADNLKFPVAFGESNDYFAGALGGVAGIPFMVMFDN
    KGKIIENFSGLVPEEILSTEIERNF

    >gi|154148569|ref|YP_001406965.1| methylated-DNA--protein-cysteine methyltransferase [Campylobacter hominis ATCC BAA-381]
    MEKILIASPIGNLKIVANGDEIIEISFCDNCEQMEISNNKHSEILTHCADEISAYFRGEISKFSVKFKIEGSDFEKSVYE
    ALLKIPYGEVLTYKQLATKINRPKAYRAVGNANAKNKIPIIIP
    CHRVVASNGIGGYSGGLWRKNRLLKLEKAKLKF

    >gi|154149535|ref|YP_001407146.1| disulfide bond formation protein B [Campylobacter hominis ATCC BAA-381]
    MNFIYKISKLQDRRFIWILMSVIMLSFVAIAYGFFQKYLYMQPCKQCIFIRISMLIIALGGIIAAIKPTDIFLKFCGYIL
    GIGASIAGIIFSTKLNTIKEMIQNNKEIDLSNISG
    CAVSPAINLNTTSQSSIMPNLFDATGGCGYDSPVVPPDTALSDLQ
    NYFVNLYSDGWYLVPSAKFGSMASCTTFAYSLTIFLLCVMLICYIYTKFKPKMKF

    >gi|154148991|ref|YP_001407288.1| selenide, water dikinase [Campylobacter hominis ATCC BAA-381]
    MKYRDFNLTKFIKSAGCAAKLDPADLNQNVANLIDNDERLLSSTHSNEDASVFSICDFTNEIYNNSILNSSEISQKNSPK
    NFKSDKNLCNKISNFGEISLVQTLDFITPLVDDPFIYGQIAAANSISDIFAMGAKPINALNIVGFDECNFGGEILSEILA
    GGKSKIKEAGAVLVGGHTIRSAETFYGLSVTGLVKGRDFWANNTAVAGDVLILTKPIGTGIITTAIKSKMIDFKDFEDAI
    ESMISLNFKACEILRNYEIHACTDVTGFGFLGHLSEMLNKNISFEVSSQNFHYFKSVKKCLEMGLIPGGSYKNSEFTSKF
    CDKKPPIELCDAQTSGGLLAAVSENEVAKVLNHLQNEGIDAFLVGFAVPKKEFEIYIK

    >gi|154148995|ref|YP_001407293.1| thiol peroxidase (scavengase P20) [Campylobacter hominis ATCC BAA-381]
    MATVTVGGNTVNLTGKELKVGDKAPVVEVCGKDLSSVKVGGKCDKIQIIATVPSLDTGVCATETRKFNKNAAGKTNVCLT
    VISMDLPFAMGRFCSTEGIENLTVASDFRNKDFGNAYGVLMKDGKLAGLLARAIFVVDKDGTIIHKEIVSEVTTEPDYEA
    IQAAVKAHGGCGGSSCGCSSK