Campylobacter fetus 82 40 uid58545

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118475037|ref|YP_891456.1| alkyl hydroperoxide reductase TsaA [Campylobacter fetus subsp. fetus 82-40]
    MLVTNKAPALKGVAVLGNGQIDENFELYKNIGSKGAVVFFYPKDFTFVCPSEIIAFDHRYKEFKERGIEVIGVSCDNEYC
    HFAWRETDVKCGGIGRVQFPLVADLKKEWAKGFDVLFDEAVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMVRMVDTML
    FTNEHGEVCPAGWSKGDKGMKPSTDGVASYLGENGDKL

    >gi|118474749|ref|YP_891497.1| thioredoxin [Campylobacter fetus subsp. fetus 82-40]
    MGKYIELTSENFNVAKEGVALVDFWAPWCGPCRMLAPVIDELAAEFDGKAKICKVNTDEAQDLAVEYGVRSIPTLLFFKD
    GQIVDQMIGAQSKIAIADKINSLL

    >gi|118475069|ref|YP_891498.1| thioredoxin-disulfide reductase [Campylobacter fetus subsp. fetus 82-40]
    MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEMENYPGVATVMDGLSFMTPWTEQCTRFGLKHEMAN
    VQRVSKNSDGSFSIFLEGNKVETAKAVIVCTGSTPKRAGFKGEDEFFGKGIST
    CATCDGFFYKNKEVAVLGGGDTALEEA
    EYLANICSKVYLIHRRDSFRAAPITVEKVKKNPKIELITNARVDEVYGDSVAGVKGVKVKLQDGSVRDLAVPGIFTFVGL
    DVRNDVLKDENGNFICDTLSTGQVRVNLKMQTNIPGLFAAGDLREDAPKQVVCAAADGATAALSAMSYIESLHY

    >gi|118474406|ref|YP_891513.1| anti-oxidant AhpCTSA family protein [Campylobacter fetus subsp. fetus 82-40]
    MACNDKKESNLCAPKTKESAQTTVFLPEDVERKVTLKAGDIAPSFELENADGVKISLKDFKGKNVVLYFYPKDNTPGCTT
    EACEFSANYDDFIANDTIIIGISPDSVKSHSNFIEKQSLKHILLSDPEKEIAKAYGVWQVRKNYGKEYLGIVRTTFVIDK
    TGKIAKVYKSVKAAGHAMKVLADLAK

    >gi|118475318|ref|YP_891634.1| putative disulfide oxidoreductase [Campylobacter fetus subsp. fetus 82-40]
    MEFFKDLKSDPIGKVASLQDERAIWIIMVVAMSGLVIVAHSLFQNYVYMAPCEQCVYIRFSMLVMALGGVIAAINPKNII
    LKIIGYVLGFYGAIIGMMYCIKLNSIHHAVHSEDPFGVQG
    CSAEPSFPFGLPLDMWAPDWFKPTGDCGYDNPIVPDDVSL
    SWLQQWFVDFYSEGWYLIPSLKFMNMAQACFIAYAVAFILLFAMFICWILKLKRA

    >gi|118475297|ref|YP_891666.1| hypothetical protein CFF8240_0470 [Campylobacter fetus subsp. fetus 82-40]
    MNIPNENIVDIRLPSEWMEYGILEGSKLITYENASGKINPMFVRLVEQHFKKDDEFYLMCATAKRSKAALKLLQNNGFKN
    VKEIKGGAYYYEKMGAKFEKFAL

    >gi|118474162|ref|YP_891694.1| thiredoxin [Campylobacter fetus subsp. fetus 82-40]
    MKSRSLIIAFLLIFAYGCSKEGKNEETAMEGSSSAVIGEDYSRAFSLSLNSGETLYMQRNQKGFDIEDNNKAVLFAFFAT
    W
    CPPCKAEIPYLVNLQDKFEKNLRVVGVLMEDRTNDEIKEFIKMYNINYDIAYGDNNYFFAKALGGVVGIPFMVLYYPDG
    KYANAYTGMVPLEMLESDVKKVIL

    >gi|118474754|ref|YP_891720.1| hypothetical protein CFF8240_0530 [Campylobacter fetus subsp. fetus 82-40]
    MKNIVFAAVFTLILAGCGSGLKHHMALNDKDGFDTIYDPALKELKIANWNEPYILFFFTTMCGACTAQVPALNELVKEYG
    SKIKVIGVMGNSLGFDGDMMALKDKGVEFMSVSTKKSVDYFSNIVGGIMGTPVTYVFDKNGKISKQFLGLYPKSALENEL
    KLLLN

    >gi|118475590|ref|YP_891776.1| putative inner membrane protein [Campylobacter fetus subsp. fetus 82-40]
    MLNLLNSFKQKYIVNFWDVGKAMIALAILSAVYFGIFGGVWAVTGEMTRWGGEFLELFGMDLSSYSYYKMQNLNGTPLTR
    FEGIMLIGMFLGASIAAFMANKVKFRLPVSGIRVFQAIVGGLLSGFGARLAFG
    CNLANFFTGLPYFSLHTWLFAVFMVIG
    IYCAVQVGKFKIFRPKVVLERCGVNGKGIEHDKNRANRHFAYGVTILVFSIIWLVYLFINVPSFDLKVKASISPLALIFG
    IAFGFIISKGQVCFTSCFRDLFLFGRDTAAKGAFFGMIIATLIVFVLMLNGYNSKIISFSPAVAIGAFLFGFGIVFAGG
    C
    ECGWTYRATEGQMHFMIVGISNFVGTAILALNYDRFPDWFKDGPKINLLDAFGSLGGLALNLSLFVVALLLVVFYKKRFF
    AKGGY

    >gi|118474618|ref|YP_891799.1| hypothetical protein CFF8240_0623 [Campylobacter fetus subsp. fetus 82-40]
    MANCAINSCTRLDPIDKAGLEALIKAGKENPDVIKTLKCRTVAEGKFRHANYIRNLPAYIVDEPPTLLGEDTAPNPSEAV
    LAALGS
    CIAVGIHANAIAQNIVITKLEVELEGDLNITAVWGTGDLSEKPLGFTDVRVKVDLQSNADKATNEALIAHALKY
    SPVANTLLRNVNLEVK

    >gi|118474851|ref|YP_891811.1| oxidoreductase [Campylobacter fetus subsp. fetus 82-40]
    MENIYDVVVIGGGPFGIATVVEAKYNGFKNVLLLEKGDNHSQTIRKFYKDGKRVDKVYKGLDSQTHGNVEFFDGTKESTL
    NYFDNLLDNGKIDAVFNIEVESVKKDGDIFNIVTSKNTYKSKNVMIGIGRMGKPNKPEYKIPPSLTQIVNFNLNS
    CNCGE
    NILVIGGGNSAAEYAIELSKCNTVTLCYRKEKFTRLNEINEAQVFEYFNDKKLNLKLGIDVIGLDNENGKVKVNFSNNSS
    EIYDRIIYAIGGSTPVDFLQKCGIELNKDGEPIVDEHLQTNTPRLFVGGDIASKNGGSIVVALNDAHTVIDYIIKSK

    >gi|118475764|ref|YP_891886.1| thioredoxin domain-containing protein [Campylobacter fetus subsp. fetus 82-40]
    MKKLTLILTFLTLFLVGCSTQKEEETTSFTPYKTGDEIELTSVIGSKTTLVRTQNGFKLKDSDKIVMIDIFGTYCVPCQK
    EAPHLMDYQLKNSDDFMIIGLIYFENIDDKGIVENFSKKYNAYYFISNSKENPRIVDQILHDIDYKRALQIPFKVVLKNG
    VYQTLSDTLGDSKTNKFYLGEVSTAVISKDVSRIKSAN

    >gi|118474801|ref|YP_892127.1| thiosulfate sulfurtransferase [Campylobacter fetus subsp. fetus 82-40]
    MKKILLILTALSVYLFGKVTTVDFNEEILNDKDIQIVDVRTPSEWAQTGVFKGAILVTYKNSDGSINPNFVNEVKSKLNT
    DKKVAVI
    CRSGNRSRPASVLLDEGGVKNVINIDGGMNKAVDKNIPTIKP

    >gi|118474928|ref|YP_892164.1| methylated-DNA--protein-cysteine methyltransferase [Campylobacter fetus subsp. fetus 82-40]
    MKIAYMKTPVGNLKISCHDGKITNIDFCDEFLDLEVNDKNLSLCIHELELYFQGKLINFTTKINIVGSEFEQKVYKALLE
    IPYGNTVTYKYIADKIDSPKAARAVGNANSKNKIPIIIP
    CHRVVGVSNLGGYSGGNGIETKKILLNLEKSYL

    >gi|118475366|ref|YP_892248.1| thiol:disulfide interchange protein DsbD [Campylobacter fetus subsp. fetus 82-40]
    MHKLLISFILLFSTVFAEPLSVEDAFKVNITGDKTQGININLVVDKSVYLYKDKLKVKVSDTDITEFLNLPKYEKHDEYD
    IYGGTFDLFIPEGLLKNFVNSNEFDIQLNYQGCSYSGFCYQPIESHYVVTYDGDKAQVKEVSASKIISSNSKINKKNIVD
    SQQDKIAKSFTDEGKLFTIITFFGYGLLLSLTPCIFPMIPIVSSIIVSKTGQKPSAKTGFWISLVYVFFMSLAYALAGVL
    ASVFGASVQGLLQIPSVIIGFSIIFVLLSFSMFGFYNIEMPKKIQNYINLKSEKKGGIIGVGIMGFLSALIVGPCVAAPL
    AGALLYIAESGDALFGGIALFVMSVGMGVPLLLIGIGSSKLLPKPGFWMEEIKRIFGFLMLAMAIWMLDRVVGSEISNAL
    YGVLGVFFAVYLGAFNEAKDGAAKFLKSFGILIFVVSIILVSIFSISTFAPNLSSYNNSTISKNSIDKIEFSYISNSKDL
    EAVINSSQKPVMIDFWATW
    CVNCKELDEKTFTNPDVIKRLKDFTLIKIDVSDNTPEDIAMMRKYNVFGPPALIFYKDKKE
    LNSKQLVGYVSYDEFLKHIEDI

    >gi|118474612|ref|YP_892435.1| peptide methionine sulfoxide reductase MsrA/msrB [Campylobacter fetus subsp. fetus 82-40]
    MKKILFVVATIFMALFLNAKENDMRNLKDIYLAGGCFWGTQAYFDKIRGVIKTDVGYANGKSDKTDYHSLHYSGHAETVH
    ITFDENIVSLAEILAHYFRIIDPFSVNKQGNDVGSQYRTGIYYNDSSLKNSISEFIKHEQTKYDKKIAVEVEPLKNYVLA
    EDYHQKYLDKNPGGYCHVDLSLADKPLYNESKFKAPSKDELKAKLSDLQYSVTQEKATERPYSSEYDKFDKKGIYVDIVS
    KKPLFSSSDKFDAGCGWPSFTKPITTDALGYNRDLSHGMERVEVTSSLANSHLGHVFTDGPKDKGGLRY
    CINGASLKFIP
    LEDMEKEGYKDYIIYVK

    >gi|118475762|ref|YP_892559.1| copper-translocating P-type ATPase [Campylobacter fetus subsp. fetus 82-40]
    MGNFVCLHCKGEFDDSGAIKDNDGCEFCCNGCKNVYSFLNSNGLGEFYERLGREKHIKASNQTLSEEPCKSFYKNYVKSD
    GGFCEIYLIIEGIH
    CSACIWLNEKVLAHTDGIIEAELNSATNKAHIKWDDNTVKLTEILNKIRAIGYNPIPYDPNKAELR
    ASTKRREFYAKMLVGLFCTMNIMWVAIALYGGYFSGMSQDVKDILHFAEFVLASPVLFYTGSEFYRSAWMSLKNRSASMD
    LSVAAGASIAYFYSVYAMLFRQGEVYFDSVAMIITFVFIGKFLEIVSKKRSIDNLDSLSSMLVSEIYVKNGNDFELKDVN
    EVKEGDIVMVRPGERVQIDGEILNGVGSFDYSSLSGESAPILLKTGDNITSGVICVDGSVEYRTSKSFESSVLSKIIALL
    EKASFKKPRIEELANQISARFSFAILALGFATFLFWYIYFGSIPNAVVVAVSVIIIACPCALSLATPVATLIGLGVGLKK
    GIVFKEARILESLAKCECVVFDKTGTLSKAKLNLIKATKFTEFDQNLLYSLLNVSTHPVSVALKNSLDGSIYQLSDVKNI
    LARGVKAKFKNISLAGGSSEFMRELGFGEFESESLSYYFAIDGKVAASFELADELRDDAKIVVNDLIKSGYKVVMLTGDK
    KSVANKVANELGISEFYAETTPIEKSRIIKELNNNMQVVMVGDGINDAVALSSAKVGICLGGGAQISVEKSDVVLLNDSL
    KSLKDALDISKFTFKTVKQNLGFSLFYNAITIPLAMAGFIIPLFAALSMSFSSIIVVLNSAKIRIKFKG

    >gi|118474630|ref|YP_892681.1| putative periplasmic protein [Campylobacter fetus subsp. fetus 82-40]
    MKNVLIISSLIAATSMFAINDAEILDLFKAASNEGLQVKIESKSKLEGTNFDQIIVNITDGKQSQKQVLFTDGKYVFPDI
    IDVNKRVSYLGKFNDIQEKASMGEAYSKLAALIKNLDKSKIINLGNDPKKPTKYLFTDPD
    CPYCRIELDRIEKDLEESNL
    KVIMAPIPSHGEDAIKKSIAIYKEVKGVKDDATKIKILRKYYAKDASAPTNITADQVKTEQANIMKYFETGAIRGVPAMI
    DESDLK

    >gi|118474286|ref|YP_892792.1| disulfide isomerase [Campylobacter fetus subsp. fetus 82-40]
    MGFEFKKTVLIGALAISTFLSAATEGTEYIKLTKAQQIPNADDKIIELLSYGCIHCYNHFKNGTLKFVSEFFPEFKYEEW
    QVKQMGEYGYQMAEVLAYAKMLDGKSGINSLSVKSSFHQILKAYFEANFKQRKRYNDANAFYQVAIDVLKNQLNKDVSVQ
    DIIDYAKSDAGKKQIQRFDDGFEVAKLNGTPAFIIKGKYLINLEKIGSAEELVEVISEIVKLD

    >gi|118475243|ref|YP_892893.1| thiol peroxidase [Campylobacter fetus subsp. fetus 82-40]
    MSNVTFQGNPVTLSGNSVNVGQVAPEVELVGKDLSTFKVGGATGKYQVLVVVPSLDTGVCAAEARKFNEKMASKSGVSIS
    IISMDLPFAMGRFCTTEGIENLRVGSDFRGAKFGNAYGVLVKDSPLEGLLTRAVFVLDKDGVVKYKEIVSEITTEPNYEA
    VLHAISDGCGCH

    >gi|118474667|ref|YP_891633.1| disulfide isomerase [Campylobacter fetus subsp. fetus 82-40]
    MRVNLLIKKCIAAAVFGAINAAAFSEGVDFVKLETPIPNSDGLVTKVYSYDCPFCYKYDKAVTKAVMQKLPEMKFEPMHL
    ATKGKFGKQASELFAVLIAKDNASGTNLLDDKSLFKKAKFAYYKAYHDKKERWGGDANNQENVNAFLSVGFEASGINKAD
    LEAGLKDEKVKAMLERWGMDANSGYAYGVAKIQGVPAFVVDGKYLIYTKAIKGIDAMAELIKYLHTLK