Campylobacter curvus 525 92 uid58669

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|154174395|ref|YP_001407510.1| thioredoxin [Campylobacter curvus 525.92]
    MGKYIELTTANFNVAKEGVALVDFWAPWCGPCRMLAPVIEELAEDFDGKAKICKVNTDEVQDLAVEFGIRSIPTLLFFKN
    GEVVDQMVGAQSKQAITDKLNSLL

    >gi|154174477|ref|YP_001407512.1| thioredoxin-disulfide reductase [Campylobacter curvus 525.92]
    MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGEPGGQITSSSEIENYPGQKSPGESGFDFMSTWWAQCSHFGLVHKWA
    NIVGVRQNADKSFEILLEGGKSEQAKAVIVATGSVPRRAGFKGEDEFFGRGVST
    CATCDGFFYKNKEVAVLGGGDTAIEE
    AIYLANIASKVYVIHRREEFRAAPTTVQKARQNEKIEFITSATIKEAYGDKSGLNGLILNTKEGERDLKVPGVFTFVGLN
    VNNEILKLEDGSFICKMSEGGQVDVDLKMQSSVPGLFAAGDIRKDAPKQVIVAAGDGAVAALSAMSYIESLH

    >gi|154173944|ref|YP_001407531.1| disulfide isomerase [Campylobacter curvus 525.92]
    MKTSILSKIVKILALVSFLSITASAVQEGVDYQVLQKPLNVPKNSVVKVFSYDCQHCYKFDKSVTKKLMSKLEGVRFIPY
    HLSSKGKLGETASKIFASLIAIDEANGTDLLSDESKFKKAKFAIYKARHDKNDDFDNGKDKARFIKLALDAAGASQDEYE
    KSLASARAQELLNAWFDSYDVAIISGVPAFVVSGKYLINLDSATSIDKMAEIAKELLAK

    >gi|154175068|ref|YP_001407532.1| anti-oxidant AhpCTSA family protein [Campylobacter curvus 525.92]
    MSEFSKEDMERKVTLEVGDKAPNFEALNQDGVKVALKDFIGKNVVLYFYPKDNTPGCTTEACEFSANYDDFIANDTVIIG
    VSPDSVKSHVNFIAKQNLKHILLSDEDKQISKLYGVWQVKKNYGKEYLGIVRTTFIIGKDGKILKVYKSVKAKDHAAKVL
    ADLAK

    >gi|154175530|ref|YP_001407842.1| copper-translocating P-type ATPase [Campylobacter curvus 525.92]
    MPKSVKLNIAGMSCVNCSNAIEKVAKKLDGVLEAHVNFANATGEFILRDDSVREILEAKIKKLGYDIATDLDEFEQKRSE
    HIANMRNKFLFAFAASLVIMGLEILGKRGVLNDVLMLALAFLTLVFSGRDFFTHAYAAIKNKNYDMNVLVALGTSSAFLY
    SLFVFLFPNALPSDLRNMYVSSSAMIIAFVLLGKYLEERSKARAGDYLKTLLKISPKTAILIKPDGQNVEVSVEELKLGD
    VVVVKNGYNVPCDGVIVQGGAEIDASMLTGESLPVYKEAGDEVFAGTLNTNGYISVKVSKGSHQTLLSQILNLLNDASTK
    KMPISRLADKIANIFVPSVICISLLAFFVWMVFSGNFAYAVSSAICVLIISCPCALGLATPIAIITALARGAKDGILIKN
    PEVIELVKDVRFVAFDKTGTLSKGQISVKSCKLSHDDLLLAASVEALSEHPISKAVVKFAEQNSIKSMKLEGKFENIVGY
    GVIYEDDKNRVVIGNESLLAKNGVLIDDEKKGEISGILDEGSGIILCAINGEFRGFISLSDELKSGVKEALGELENLGAQ
    SVILSGDNEKVVSHIAAQLGVDKFYANMLPNDKFEKIKELSRQGKVVFVGDGINDSPSLKEADVGIVMNSGSDIAKMAGD
    IVLMKNDVKGVASSLKLGKSTMRTIKENLFWAFVYNVVCIPVAAGVLYPIFGILLSPVYGALAMCFSSVTVVLNSLRLRY
    LKF

    >gi|154175211|ref|YP_001408039.1| cytochrome C biogenesis protein transmembrane region [Campylobacter curvus 525.92]
    MVFKILVSFFAFCLTCFGEVLDVSKAFDISTAQDSQNLEIKFKFGENIYIYQDTFEIKLNGERINSLLNMPKPESVGDHE
    IILQDFSLLVPFKLVGENLKDDKARLEILYQGCAKNGICYRPQSKIYTITKIDDKFSVAAADKQDTNQLSDEENIASELD
    SSGFLLSLATFFGYGLLLAFTPCVFPMIPILSSIIVSKSGRNLNAKTGFMLSLVYVVAMSLAYALAGVAASLLGFGVLGA
    LQNVWVLSVFALFFVLLASSMFGFYDIKLPSKFENLISKKSQNSSGLIGVFIMGFASALIVSPCVAAPLAGALLYIAQSG
    DTFYGGTMLFGMGLGMGVPLLVIGASSGKILPKPGAWMDGIKSLFGFLMLIMAVWLMARIFGSFFELVGYGVIGVFMAVY
    FGAFEAAASGAMKFKKALAILVFVYSIMLIAGGFLGSRDALSPLSGLNFTSFDQAQLNFRSVKNLNELKDLIKNADKPVM
    VDFYADW
    CASCKEIEKITFKDSAVAGKLGDFTLVRVDVTQSGEQNDAILREFGLIDPPALLFFKSGEELKPLRTIGFISP
    EKFLEKISKI

    >gi|154174582|ref|YP_001408113.1| thiredoxin [Campylobacter curvus 525.92]
    MNFKNTIIALSCAFLFFGCGGDDKKNGQTSSDAQIEANKTDANLSQNSAKSEPVVDLHLNLLNGKTINLQKRKDGFDIKD
    NDKATLFVFFATW
    CPPCRAEIPHLNNLSEKFKEELNIIGVLLEEKNEQEVKDFAKKYNIKYDVAVGEGNFLLEKAVGGII
    GLPSSALYKPNGDYAIHYTGLVPEEMLENDILKAIK

    >gi|154174369|ref|YP_001408124.1| methylated-DNA--protein-cysteine methyltransferase [Campylobacter curvus 525.92]
    MQKAYFDSPIGVLEICGDESGVCELNFVREFIKTDVTDANLKLCLSELERYFKGELKIFTTKLNISGTVFQKNVYENLLK
    IPYGETITYAQLAQMTGAERAYRAAGSANAKNKIPIIIP
    CHRVVATNGLGGYSGGKGLATKIWLLEHERANLAK

    >gi|154173981|ref|YP_001408210.1| putative disulfide oxidoreductase [Campylobacter curvus 525.92]
    MNLVQKIAKIQDSRYTWALLIFVSAGLVVLAHSLFQEYVYMPPCEQCVYIRFAFLCMALGGVIAIIDPKNLALAAVGYIF
    AFWGAVQGIMYSVKLAKIHAAVHGDDPFGVQG
    CSTEPHYPFGIPLEKWAPDWFLPTGDCGYDSPIVPDGVTLSGVQKYLV
    GLYQDGWYLIPSSKFMSMADCTLIGFGVCFVILAAMLVCKILTLKAQKSV

    >gi|154173723|ref|YP_001408211.1| thiol:disulfide interchange protein DsbA [Campylobacter curvus 525.92]
    MNSFFNKAAKGLLAVAMFAGVSASAFTEGEDYVKLEKPLDVPQNTLVKVFSYACPFCYKYDKTVTPKVVEKVQGLKYVPF
    HLKTKGDYGEAASKVFAVLITMDEAKGVSLFDENSLFKKAKFAYYKAYHDKKERWNDGKDEAAFLKTGLEAAGVSEADYQ
    KELENPKVKELLSKWDAAYEVAKIQGVPAFVVNGKYLIYTKSISSIDGMAALIEELLKK

    >gi|154174479|ref|YP_001408354.1| oxidoreductase [Campylobacter curvus 525.92]
    MANVYDLIVVGGGPCGIAAVVEAKRSGLHNVLLLEKGDNHSQTIRKFYKDNKRVDKEYKGQDSTIHGVVSFEDGTKESTL
    DYFDKLLDDERIEAFFNSEVESIKKESDLFHVRTASADYKAKNVMVSIGKMGRPNKPDYKIPPSLNNVVNFNLDN
    CTNGE
    KVVVVGGGNSAVEYAIELCQYNKTTLAYRKDKFNRVNDTNLSALWELEKLGKIKVRLNHDIKEIDNESGRVRVHYANDKI
    RVYDRVVYAIGGSSPIDFLQKCGIATDEKGTPLVNENFESNIKGLYVGGDIVLRNGGSIVVALNHAHTVLKDILAQG

    >gi|154174284|ref|YP_001408427.1| peptide methionine sulfoxide reductase MsrA/msrB [Campylobacter curvus 525.92]
    MTRTLKIFLGFAAAIMLAVGFANAQNEIKGPLMAQKNLKDIYLAGGCFWGMEGYFKKIAGIEQTSVGYANGKSDKTSYHE
    IDATDHAETLHIKYDANRIDLAEILAHYFRVIDPTSVNKQGNDIGRQYRTGIYYVDAQDLPVIEAFIRFEQSKFKDKIAV
    EVAPLKNFVLAEEYHQDYLDKNPFGYCHIDLNLAKKPLYDDEKFKMPSKSELKEKLTAEQYAVTQEKATERPFSSKYDKF
    EERGIYVDVVSGKPLFSSSDKYDAGCGWPSFTKPITADALKYEQDNSHGMSRVEVTSKISDSHLGHVFDDGPSERGGLRY
    CINGASLKFIPLEDMQKLGYGEYIPYVK

    >gi|154175400|ref|YP_001408539.1| hypothetical protein CCV52592_0694 [Campylobacter curvus 525.92]
    MKNLIALIFALFIFSGCGTEEKNQAASFKEFSPNEEVALKGVNGKTITLVRKNGAFAIKGDESKILMIDIFGTFCPPCQK
    EAAELTKYQLENSDKFTIIGLTHFENVTDDYVLKEFVQKYNAYYFITNDQSVNDRLSEQIVRDIGYKHEIALPFKVVIKD
    GEYQILTDVDSGEFGVKYYLGGIKVSRMKQDLQRIYGSN

    >gi|154175225|ref|YP_001408577.1| copper-translocating P-type ATPase [Campylobacter curvus 525.92]
    MKKCKCSHCQLEFDESSMISAPDGNKFCCSGCKNVYEILRSNGLEEFYERLGKNTLSPAKESENFDDSARDIYRDFIKKD
    GEFSKISLVIEDIH
    CFACIWLVEKVLFGTNGVLEAGVNATNNKALIVWDESQVGLNEILRRLNSVGYKAHPYDAEGEEAR
    LSAKRREFYAKLLVGIFCTMNIMWIAVAQYSGYFSGIRADVKAILNFAEFVLATPVLFYTGGAFFAGALTALKGRTPNMD
    LLVATGASLAYIYSVYAMFSRSGEVYFDSVAMIITFVFIGKFLEILSKKRAADSIDGLNHMLLGDVSVLKDGEILQINPQ
    AVSIKDKIVLRAGQRALIDGFIVRGEASFDASSISGESAPVWLGVGDEVKSGLICLDGRVIYEASANFENSFLSKIVALL
    QNASLKKPRIEQLANKISSKFSLGIICVALVTFTFWYIKGGFENALILAISVIVIACPCALALATPVGTLVALGVGLKKA
    VIFKEAAMIETLANCDTVVFDKTGTLSTGKLCVSKFIKFSDIDTNVIFSLAGASKHPVSVGVAKFLAGNGAKALELSDVK
    EIAAKGVSAKFKGKILAAGSKNFMRELGVDISHSKSDKTSYYVAFEGVLAAKFELSDELKNDAKSCVKELKAMGLKTYML
    TGDNQNVAKEVTDALGIVDFKASCLPDEKARFIKNLQQNGAKIVMVGDGINDTLALSLAQIAVCMGSGADASLAKSDVVL
    LDDSLKSLLNAVKIARFTLGKIKQNLAFSLCYNLLTVPLATMGYVMPLFAALSMSFSSIAVVLNSLTIRAKFKENDE

    >gi|154174658|ref|YP_001408595.1| pyridine nucleotide-disulfide oxidoreductase YkgC [Campylobacter curvus 525.92]
    MKYDIIVIGFGKAGKTLAAKAGALGKKVALIERSPQMYGGTCINIGCIPTKRLVTAAKEAQFVNNNVEGDYYTLSIQTKD
    KLITALRAKNLGMLKDNPNIDVIDGVGYFLDKNSVEILTADGSKCLIDGDTIVINTGSKEADAPFEVKSDIAYTSSEILN
    LKTLPKHLVIVGNGFIGLEFASMFAGFGSKVTIVGRGKFMKNEDDDVANSVKEALVAQGIEILEDCNISSLMGRGLNFSQ
    GGMSKSIIADAFLLAMGRKAVTEGLNLDKVGVKIDEKGNIVVNEFLQTDTPNIYAVGDVRGGELFTYTSLDDFRIVFDKI
    FGKGERSTKNRAIHANTLFTQTPLAKVGLSQKEATALGKDIKILKLSMSAVPGAKVVNHDIGMLKAIVDNKSGEILGAAF
    HCIYAHEIINEVAIAMNFKANAGFFKNQIFTHPSISEALNDLFGQF

    >gi|154174778|ref|YP_001408675.1| SCO1/SenC family protein [Campylobacter curvus 525.92]
    MKKVFGFLVFLLICGGALFLLIKPNKYDFTADSANGQVTLKNFDGKYKAIYFGFLFCPDVCPTTLSLLGEQLEALKRDDF
    ELIFVTLDPERDTPENLTLMAQNFYKNSIGLKMKNLAQVTKHYGVKFKKVQLKDSALDYSIAHSSSIYLLDKEGKFFSEI
    SNLTKENIKDNLQNMIKERP

    >gi|154175542|ref|YP_001408847.1| membrane protein [Campylobacter curvus 525.92]
    MLVTKKAPDFTAAAVLGNNQIVNDFNLYKNIGEKGTVVFFYPMDFTFVCPSEIIAFDKRYDEFKARGIEVIGVSCDNQFS
    HFAWKETPVNKGGIGKVRFPIVADMTKSIARGFDVLLEDAGVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMIRMVDTM
    LFTNEHGEVCPAGWHKGDEGMKPSTEGVADYLSHNENKL

    >gi|154174536|ref|YP_001408892.1| hypothetical protein CCV52592_1651 [Campylobacter curvus 525.92]
    MFKIFKILLFCAVVFCGCGGEKSTMNYDRNAIPLDITSVDMKYIKSKKMPAILDFGADDCEYCVKMRPTLERLNKALQGK
    AILHFADIGKRPGLAKNLPVKFIPTQIFINADGSAFEPSEILERSLNLQKIYAKNDPSKHLYTIHEGELKQEDLLDILAQ
    MGVKVSSSEDL

    >gi|154174892|ref|YP_001408894.1| MoeB/ThiF family protein [Campylobacter curvus 525.92]
    MNETIDRYTRVRWLFGDENFDRLKRAKVLVCGVGGVGGMCLDALARSGVGEITAIDKDVFDITNQNRQIYSEAVGAVKVG
    EFAKRYECVRAVKELMTPEFIAKFSFDEFDVIIDAIDDMSAKIALANAVDTSKFIASMGGAKRIDPAKIKVASVWKTSVD
    PLARKYRYELKRSGFKGDFEVVFSTEMPL
    CKPLGSFMGVTACFGLNLASLAVRKILNLA

    >gi|154174600|ref|YP_001408933.1| thioredoxin family protein [Campylobacter curvus 525.92]
    MMKFWFKIFIFSALIFAGCAKEYEKHHITLNDPRGIDTQFFPSQQRLKMGDKPYMLFFFGTDCGVCKKQIPDLNELYKIY
    GDRMEFIGVLGPSKGFDKDMALLKEHGIEFKTTSDKVSVDYFSKAVGGVMGVPVVYFFDKSGKMSGKFIGLTPKSVLEGA
    IKSAL

    >gi|154175084|ref|YP_001408947.1| multi-sensor signal transduction histidine kinase [Campylobacter curvus 525.92]
    MKKIVLTSMIAASALFAATDAQILGFYKQIVPQGVNVEISSRHKLSDHQEYEAVVLTLNNGSISQDEIIFTKGDLLLPDI
    LDLKTGKSYKGELQEQMMITKLSAIYKNEDAANIIRLGNDSKKATRVMFSDPE
    CPYCREELKNIEKTLQNENLKIILTPV
    HDKSALEKSYLIYKDLKSVKSDSDKVKVLRKYFAENFKVPEHSVTDEQVAQMDNLRRKYLLAGLRSVPFFVDETILTKK

    >gi|154174849|ref|YP_001408982.1| putative BcpB [Campylobacter curvus 525.92]
    MIKIPTSIHLKGLKGEDFDFSAFARTHDCVVFLYPKMGESGKFLSEQLKNTEGMTGCTVQAGEYKRLMSEFNELGFMVVA
    IGTQDLAEQIKFKEDTGAQFMFLNDADFALERALELPVFSSGDGKKFYFRQTLIIKGGKIVRADLVLKPQDDAKNALELI
    KNRAF

    >gi|154174915|ref|YP_001409037.1| thiol peroxidase (scavengase P20) [Campylobacter curvus 525.92]
    MATTKFKGSVVNLGTNSVSVGEKAPIVKVVGKDLSDIQIGGEQGVVQIVVAVPSLDTDVCAMEAKKFNVKAASIQNAQLI
    LISMDLPFAMGRFCQAEGIENVKVASDFRAKEFAKAYGVLIEDGVLTGLTARAVFVIDASGVITYKEIVAEIADEPDYEA
    ALKAINEAASTCCGS