Campylobacter concisus 13826 uid58667

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157164144|ref|YP_001466030.1| thioredoxin-disulfide reductase [Campylobacter concisus 13826]
    MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGEPGGQITSSSEIENYPGQKAPGESGFDFMSTWWKQCSAFGLVHKWA
    NVIGVRKNSDGSFEILLEGGKSEQAKAVIVATGSTPRRAGFKGEDEFFGKGVST
    CATCDGFFYKNKEVAVLGGGDTAVEE
    ALYLANICSKVYLVHRRDEFRAAPTTVEKARKNEKIEFITSATVKEALGDNMGLTKIVLDTKNGERVLDVPGIFTFVGLN
    VNNEILKDENGKFICEMADGGQVKTNLKMQTSLKGLFVAGDIREDAPKQVIVAAGDGAVAALSAMSYIESLH

    >gi|157165021|ref|YP_001466032.1| thioredoxin [Campylobacter concisus 13826]
    MGKYIELTKENFDVTKEGVALVDFWAPWCGPCRMLAPVIEELAEDFDGKAKICKVNTDEVQDLAVEFGIRSIPTLLFFKN
    GELVEQMVGAQSKQALTDKLNSLL

    >gi|157163886|ref|YP_001466211.1| thiol peroxidase [Campylobacter concisus 13826]
    MKKVILASIIAATSLMAASDKQIEDFYSQMVDSSVKVKVADRHKVAGDIEAVVVKLSKDGNSQDEIVFTIGDFIFPDVID
    LKEQKSYLAEVKKEVIAKGISKIYKDEDKANIIVLGSDPKKPTIIMFSDPE
    CPYCRAELAKIETTLKDSNVEIVLTPVHD
    VSSLQKSSLIYKDAKAAKSDSDKVKILRKYYAEDYNVDDKSVSKEDVAKIDNLRKKYFAAGVRSVPFIVNKSDLK

    >gi|157165264|ref|YP_001466214.1| formate dehydrogenase iron-sulfur subunit [Campylobacter concisus 13826]
    MARMKFFVDTNRCISCFGCQVACSSAHELPVGIYRRKVITLHDGIEGKEVSTTIACQHCTDAPCEQVCPVDCFYIRADGI
    VLHDKNKCIGCGYCLYACPFGAPQFPKDGAFGVKGVMDKCTMCAGGPEPTNSHEERELYGQNRMAEGKVPMCAAICATNA
    LLVGDAAEVSNVYRKRVMLRNTGLNV

    >gi|157164992|ref|YP_001466221.1| thioredoxin family protein [Campylobacter concisus 13826]
    MKFKFLFLCLVAALVMGCVKQYEKHHITLNDSSGIDTQFFPTEKRLKIGDKPYMLFFFGTDCGVCKAAIPDLNLLQKQYG
    KDVEFIGILGPSKGFDKDIELLKEHNITFKTTSDKVSVDYFSKAVGGVMGVPVIYFFDKDGKMRSKFIGLTPKSVLEGAI
    RSLL

    >gi|157163978|ref|YP_001466281.1| metal-activated pyridoxal enzyme [Campylobacter concisus 13826]
    MNKTLLYIIAGASLGILGPVLVHFGNPANMGVCAACFLRDSMGALGFHQAKVVQYLRPEILGLIIGGFLASMLWSRNFTP
    ISGSAAFSRFFLGVFAMIGCLIFLGCPWRAFLRLGGGDMTAIAGVIGLFAGVFVGRTFKKNGYVLPESETTAKAIGFLPM
    IIAILLLIALIFGLKLGENGALFSSEKGPGSQHANLFISLICAIVIGAFMQRSKFCSVGAISKIFERDFSMFYGIVSIVL
    FASITNLVLNQYKFGFEGQPIAHNDMLWNFLGMTLAGLCFSLSYG
    CPGKHLVQMGAGNLSSAVFVLGMGAGAAISHNFVL
    ASSGAGITPYAPYAVVIGFIYAIYVGFFTKKA

    >gi|157164012|ref|YP_001466308.1| 2-cys peroxiredoxin BAS1, (Thiol-specific antioxidant protein) [Campylobacter concisus 13826]
    MLVTKKAPDFTAAAVLGNNQIVNDFNLYKNIGEKGAVVFFYPMDFTFVCPSEIIAFDKRYDEFKSRGIEVIAVSCDNQFS
    HFAWKETPVNKGGIGKVRFPIVADMTKSIARGFDVLLEDAGVALRGSFLLDKDGTVRHAVINDLPLGRNIDEMIRMVDTM
    LFTNEHGEVCPAGWHKGDAGMKPSTEGVADYLSHNESKL

    >gi|157164923|ref|YP_001466656.1| peptide methionine sulfoxide reductase family protein [Campylobacter concisus 13826]
    MKKILNFLLVLAVFLGVNLTAKDEFLKEQTMAGQNLKEIYLAGGCFWGMQGYFKKIFGVVDTKVGYANGKSESTSYQGLH
    ESDHAETLYVKFDENRVALAEILAHFFRVIDPTSLNKQGNDVGRQYRSGIYYVSKDDLPVIESFIKIEQKKFKDKIVVEV
    APLKNFVIAEEYHQDYLDKNPFGYCHIDLNLASKPLYDEAKFKPLSKEELKRNLSSEQYAVTQEAATERPFSSEYDKFDK
    KGIYVDITSGKPLFSSADKFDAGCGWPSFTKPITTTALAYSEDNSFMMKRVEVRSQNSDAHLGHVFEDGPSDKGGLRY
    CI
    NGASLKFIPLEDMARLGYEEFIPYVK

    >gi|157164867|ref|YP_001466727.1| pyridine nucleotide-disulphide oxidoreductase [Campylobacter concisus 13826]
    MTNVYDLIVVGGGPCGIASVVEAKRNGLSNVLLLEKGDNHSQTIRKFYKDNKRVDKEYKGQDSTIHGLVSFEDGTKESTL
    DYFDKLLDSENIEAFFNSEVESVKKEGEIFKVTTSKAVYEAKNVMVSIGKMGRPNKPDYKIPPSLNSVVNFNLDN
    CTNGE
    KVLVVGGGNSAVEYAIELCQYNKTTIAYRKDKFSRVNETNLSALWELEKHNKIKVRLNHDITEIDNESGKVRVHYENGKI
    RVYDRVVYAIGGSSPVDFLQKCQIKTDEKGTPIVDSNYQSSVPGLYVGGDIVLKNGGSIVVGLNHAHSVIKDILKGKAQA


    >gi|157165054|ref|YP_001466925.1| transporter [Campylobacter concisus 13826]
    MTLKHAIITSLCLFAFFGCGDDKSQKSEQNTSEPAVQSKNLEENASKDENLSKDTLTPKISESAQSDEVKEISLKLLNGT
    TMQITKRSNGFDVKDGKKATLYVFFATW
    CPPCKAEIPSLNNLSEKFKNELNIVAVLLEDKSEDEVKEFAQKYKIKYDIAV
    GEGNFLFEKAMGGIKGLPASALFKANGDYAQGYIGLVPEEMLETDINRAIK

    >gi|157164940|ref|YP_001466966.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Campylobacter concisus 13826]
    MILLVFSSKSLILLAFYQKAKQSKVKFAQNFKFQGANVSKAYLKSPIGILEIVASENGICEINFVDKFEKIAVKDENLKL
    CLDELEAYFKGELKKFSVRLDVKTTKFRAKIYDVLQKVPYGETTTYAALALAAGHKNAYRAVGSANAKNPVPIIVP
    CHRV
    LSHSGLGGYSGGEGLPTKIWLLEHEAKHK

    >gi|157164265|ref|YP_001467003.1| heavy metal translocating P-type ATPase [Campylobacter concisus 13826]
    MKCRCSHCKQSFDESAMIEASGGLKFCCVGCKGVYEILNESGLGEFYVRLGKNTLNPASSGANVKNLAANFSELVTKEGE
    FSKISLLIDGIT
    CSACIWLLEKALFSLPGILEVNINSLSQKAVIIYDEQELLVEQIIEKIYAVGYTPKAYAASQKEDELV
    KKRRNFYAKALVGVFATMNIMWLAIAQYGGYFSGIRSDVKDLLSFAQFVLATPVLFYTGSEFFKGAKIAIKNASPNMDLL
    VITGASITYIYSIFAMLTRSGESYFDSVAMIITFVFIGKFLEILGKKKALETSNFLSDMLLAKVCVLEDGKDILKEPKDV
    NLGEKIVLRAGERALLDGVVLSGEASVDSSSLTGESLPLLLGSGGEVKSGVVCLNGQIVYEAGQIFKNSYLNKLINLLQN
    AELKKPNIELAVNKIASKFSLSVLTLAFFTFWFWYFKFSFSEAVVTAVSVIVIACPCALALATPVSSVCALGVAFKNKVL
    FKEAKFFESLAKCDVAVFDKTGTLTKAKFEVGEFFIKEGVSIDKIYSLCLISNHQISVAVAEFLKQKGAKKVELENANLS
    VAKGVSADIIGERFVAGSRRFLAENGVKFEESEENVSFFVGKQGELVAKFYLKDSVKPEAKALMDELKSAGMKVCILSGD
    VQNVVKNVADELGVSEFRAGMLPDEKAKFIAGLKQQGKNVLMVGDGINDAAALSLAHVAICMGSGAAVSLEKSDVVLLDD
    SLQSLAKAVKISKFTYKTIKQNLLFCLLYNALSLPFAVCGYVVPLFAALFMSASSLSVILNSLFIVRKFKDK

    >gi|157164634|ref|YP_001467023.1| type II secretion system protein E [Campylobacter concisus 13826]
    MKYDIVIIGFGKAGKTLAVKAVALGKKVALIERSPKMYGGTCINVGCIPTKRLITAAKEAIYADNSVENEYYTLSIENKN
    KLISALNSKNYAMLNDKENIDVIDGVGSFKDKNSVLVTTSNGEQKVVEGEFIIINTGSKEAYAPFEITNSNVFSSKTLLD
    LKTMPKHLVIVGSGFIGIEFASMFANFGSKVTIVGRSKLLKNEDEDMAKSVKDALNVQGIEILEGCEIESLKDNALNFKQ
    DGEDRIIKADAFLVALGRVANLDDLNLKAAGVELNEKGFIKTNERLQTNVSNIYAVGDVRGGELFTYTSLDDFRIVFSQI
    FGDKKRTTQNRSIHANVLFTDTPLARVGVNAKEASKLGLNFKELKLSMAAVPGAKVLNHDVGMLKAIVEASSGEILGASF
    HCIYANEIINEIAIAMNLKADANFFKNQIFTHPSISEALNDLFGQY

    >gi|157164382|ref|YP_001467062.1| thioredoxin domain-containing protein [Campylobacter concisus 13826]
    MKNLLVLIIALFAFFGCGDDESSSANFKEFSPNEEVKLVDVSGKELTLVRKDHGFAIKNDENKVLMIDIFGTFCPPCQKE
    AAELTKYQLENKDKFTLIGLTHFENVTNEYVLHEFMQKFNAYYFITNDQKINDRLAEQIVRDIEYKHEIALPFKVVIKNG
    EYQILTDVDSGQYGVKYYLGGIKVTKMKEDLAKIYETK

    >gi|157164820|ref|YP_001467116.1| divalent cation transporter [Campylobacter concisus 13826]
    MFFKFIFSFILFASSLFAEVLDVSKAFVLSPSIDEQGVEIKFKFGENIYLYKDSFEVKLGEEKINSLLNMPKSENTGEYE
    IYPKDFSLFIPLNLVKEHLKNGSVRLNLSYQGCAKNGICYRPQTKIYDIFEKFGKFSIIAFEKEQKDETNPEFTELSDEQ
    SIANELSSKNFFISLVTFFGYGLLLSLTPCVFPMIPILSSIIVSKGGSLNAKKGFLLSLVYVVAMSLAYALAGVGASLLG
    FGIAGALQNIYVLGAFAAIFVILSFSMFGFYDIKLPSKFENLISKKSQNSSGLIGVFIMGFASALIVSPCVAAPLAGALL
    YIAQSGDAIYGGIMLFVMGLGMGAPLLVIGLSSGKLLPRPGGWMDEVKKLFGFLMLIMAVWILARVLGAFFELLGYGVIG
    VFAAIYLGAFEAANSGWAKFKKALCVLVFIYSLMLIIGAFLGSKDAFSPLSGLNLAKNESELNFKQARNLNELNEMIKSS
    SKPVLVDFYADW
    CASCKEIEHITFKDAGVKNALANFTLIRIDVTSGGAQNDEMLRNFGLIDPPALLLFKDGEEQKALRTI
    GFINAKNLLAKLEKI

    >gi|157163950|ref|YP_001467570.1| anti-oxidant AhpCTSA family protein [Campylobacter concisus 13826]
    MSEFSKADIERKITLEVGDRAPEFEALNQDGVKVALKDFIGKNVVLYFYPKDNTPGCTTEACEFSANYDQFIKNGTVIIG
    VSPDSVKSHAGFIAKQNLKHILLSDEDKEISKLYGVWQVKKNYGKEYLGIARSTFVIGKDGKIVKIYKSVKAKDHAAKVL
    ADLVK

    >gi|157165280|ref|YP_001467572.1| hypothetical protein CCC13826_2110 [Campylobacter concisus 13826]
    MKLIKMLILSAFFALNLSALTEGVEYQTLAKPLNVPKNSVVKVFSYDCPHCYKFDRTITRKLMSKLDGVKFIPYHLSTKG
    KLGETTSKIFAALISIDEANGTDLLSDESKFKQAKFAIYKARHDEKDDFNDGKDKQRFIDLALNAAHVSKDEYEKALSSD
    RAKELLNEWFASYDVASISGVPAFVVSGKYLINLSAASSIDDMAKTIKELLDK

    >gi|157164976|ref|YP_001467612.1| putative BcpB [Campylobacter concisus 13826]
    MIKVPTSIYLRTLDGKEFDFSAFARTHDCVVFIYPKIGEDFGLLSEQLQKTAGMKGCTKQAINYKKLLKEFNDLGFMVVA
    IGSQDIAAQKKFEEETATGVMFLNDSEFMLERALELPVFAASNGHKFYFRQTLIIKGGNIRRAYIVDEPENDAKNMLEKI
    KNEDY

    >gi|157165156|ref|YP_001467743.1| thiol peroxidase (scavengase P20) [Campylobacter concisus 13826]
    MATTKFKGSDVNLSGNELFVGSYAPEARVVAQDLSEFSVGGNNGIEVLVCLPSLDTGVCAAEARKFNEKVAGKHGVKLSI
    ISNDLPFAMGRFCTTEGIANLRVGSDFRYGEFAQNYGMLMSDGALKGLLARAVFVIKDGVIIHKQIVPEVTQEPNYDAVF
    DAIKQSGGCGCGCH

    >gi|157165175|ref|YP_001467797.1| putative disulfide oxidoreductase [Campylobacter concisus 13826]
    MSFFKKMAKFQDSRISWAILVFVSVALVVIAHSLFQNYAYMPPCEQCVYIRFAFLCMALGGVIAIINPKNLLFALVGYLF
    AFWGAVQGIMYSVKLAKIHDAVHGDDPFGVQG
    CSTEPHYPFGLPLEKWAPDWFMPTGDCGYDSPMVPDGAVLSDLQKSIV
    DLYADGWYLVPSSKFMSMADCTLLGFGVCFVVLALMLVSKLLSFKN

    >gi|157165622|ref|YP_001467798.1| integrase/recombinase [Campylobacter concisus 13826]
    MSFLSKFSKAIFAVAVAGVISASAFGEGEDYVKLEKPLSVGQNTLVKIFSYACPFCYKYDKSVTPKVVEKIPGLKYEPFH
    LKTKGDYGEVASKVFAVLIVMDEAKGVSLFDENSLFKKAKFAYYKAYHDKKERWGDGKDAEGFLKTGLDAAGVSKADYEK
    ELANPKVTELLKKWDESYDVAKIQGVPAFVVNGKYLIMTKSISSLDGMAALIEELLKK

    >gi|157165368|ref|YP_001466091.1| FAD binding domain-containing protein [Campylobacter concisus 13826]
    MISRRKFIKTSLAATTLAALNLEASQNEPKWDKEFDVLIVGSGLSANVAGIVLAEAGLKVALIEKMSRLGGNSVISQLDF
    A
    CVGSDEQVNAGIKDSIELFVKDLNKAGKGFNDVAQSLRIAENSKRSYEFVKARGVKFASKLKHLGGHSVARSLETDGGG
    GAFVQTLNSHFESKGGASLKRVKADEIIFDESGKVIGLKVREEYKFDKSLADDDIQNTTGDSKFYKANKAVIFASGGYSA
    DKAFKAAQNPRLALAKTPSNPGATAGALKMMLAAGATPIQLSLGRYSFGIPTEDLVFSMIVDGKNSKRFMNEDGDRQGLS
    DKILENMQDNNSDKFAVIIFDEVGFGSSHDPKRLNKFVEDGKMKKFQNLDELAKEFGLNLEALNSEIKRYNENIDKKDDS
    DFKKDLSRVKTISKAPFYAMLAAPGISYTPGGVRVSLNFEVLALKDNMPIKNLYAIGEATGGIHGYARLTSCSTPDCISS
    GLIAAEHILKA