Caldicellulosiruptor saccharolyticus DSM 8903 uid58289

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|146295260|ref|YP_001179031.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MINGKVELILENLSCANCAAKIEERVNSLYFVKSANLNFVTKKLTAEISPNNYKLFLDSVTRIVNEIEPNVRVLEAEAEK
    PVVDIKDLSSIILSILFFVIGLFIYKRTWWGLIFFVLAYILAGKDVIKKFLKNLLLLKVFDENFLMTVATISAFLLKEYP
    EAVLVMLLYKTGELLEETAIRRSRKTINSLKNLEIEYANLKIENEIKRVNPKDIVPGDIVIVKAGERVPIDGVVAAGRSF
    LDTSAVTGESRLIPVKKNDEVFAGSINIDGTIEVLAKSFYKDSTISKIIEIVENATSKKSQTERFITSFAKVYTPIVTLF
    ALLVALLPPLLFSQPFDKWVYRALIFLIISCPCSLVLSVPLSYFAGVARLSKASILVKGTTYIDKMARKIYAILFDKTGT
    ITQGSLKVDKVVTKDISYEEFIKLLCHIESFSNHPIALSVTKEFKVKVDAQLVKEVKEYPGKGIEGVVDDKKVIAGTKEF
    LEENGVKIDIKEDFIASTAVYVGVDNKFCGYVVLKDFLRQDIKDTLNLLKKLETKTYLLTGDKKEAAEELASELKFDGIF
    SNLLPQDKVKIAEQIKKEAKNATVVFVGDGINDSPALAVCDVGISFAQNASSIATAAADVILLENSTVKILDLIQISRFV
    RRVVIQNISTSLSIKFLVMALGALGFANLWEAVLADVGVALIAILNSLRILKNQK

    >gi|146295293|ref|YP_001179064.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MERKILDVMGMSCASCARAIEKSVSKVEGVSSASVNFATEKLVVEYDETKTNLEKIKEAVKKAGYDVKDIPDDTAKDVII
    PIGGMS
    CASCARAIEKSISKLPGIKEVSVNFATEKARVVYDPSKVRLSEIKEAIKKAGYTPLEVEETTAAESQSDHKKLE
    EQYWFKRFVISAIFAVPVLYIAMGNIIGLPLPQIIDPAKNPFNFVFIQLILSIPIFIAGIRFYTVGFSRLIQRHPNMDSL
    IAIGTAAAYIYGIYGIFKIAAGDTSFVEESYFETAGVIITLILLGRYFEVVSKGRASDAIKKLMGLAPKTATILRDGQET
    VIPIEEIEVGDILIIKPGEKIPTDGEVIDGRTSVDESMLTGESIPVEKTVGSPVYGGTINKNGTIKVRATKVGKDTVLSQ
    IIKLIEEAQASKPPIARLADIISGYFVPAVIAIAIISGTLWYVWGKPGSFALKVFITVLIIACPCALGLATPTAVMVATG
    KGAEFGVLFKSGEALETLHKIDTIVFDKTGTITEGKPKVTDIITAEGFDELEVLRLAASAEKTSEHPLAEAIVNYAKEKN
    LDLVDAQEFEAIPGFGIEATVDGKNILLGNRRLMEQRNVSIWLTDEVQRLSQEGKTAMFIAIDGKFAGIIAVADVIKPTS
    KKAIEILHKMGINTVMLTGDNRQTALAIAKQVGIDKVIAEVLPQNKAEEVKKLQTEGKKVVMVGDGINDAPALTQADVGI
    AIGSGTDVAIESADVVLMKSDIMDVVTAIDLSKKAIRNIKQNLFWAFFYNTAGIPIAAGVLHIFGGPLLNPVIAALAMAF
    SSVSVVTNALRLRRYRPAK

    >gi|146295294|ref|YP_001179065.1| heavy metal transport/detoxification protein [Caldicellulosiruptor saccharolyticus DSM 8903]
    MTKKIYIEGMTCDHCAKAVENALKELHGVMSASVNLAEKYAIVELHHPIEDEKFVAAVDDAGYKVVKIE

    >gi|146295461|ref|YP_001179232.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MKYLIIGASAAGLSCAKTLRRLDNNGEIVVISKDDMVYSRCMLHYFISDDRPLDKMRFVEEDFFDKNKIKWIRNTTVMEI
    RPFNKSVVTSDGAEHTYDKLLIATGATPVIPSIEGLAEGIEKRKDIFTLRDIGDAIKIKKAAKTSRQAVVIGGGLIGLDV
    AVSLNKQGVKVTVIEVKDHILPQQLDKTAAQRYERMFKDNGIDIITGQSVSNVIYGLSGKVKGVTLSDGSFVFADMIVVA
    VGVKPSFPRIDKCHLKIENGIIVDQYQRTSIQDIYAAGDVCQSYELLTQRHILTPIWPSAVKQGQTAAYNMAGIDRHLID
    NFGFKNSMKFFGLSTISYGYVEPPDDSYNVAICSGPNYYYKVVYKENVLYGAIIQGDISGAGVIGKLIQDKYNLSNKLVR
    NDWNNVFRLTYGDFFKQNQDGTFEFAC

    >gi|146295535|ref|YP_001179306.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MLKKEVILEGLDCANCAAKIEEEVNKLNGVKAYMNFMNKTLTLEIESEQEYKNILQQVKTIVHKHEPDVVVKEKSVNKSN
    KKVNKSIVILEGLG
    CANCAAKIEKEISGLEGVEFAAVDFVSKKLTLEISPKVNRSELNEKIEAIVKKIEPDVKVIFEENT
    SKANVKENNEEEEEGVNKKEIIRLVVGGAIFAVGIIFNFQNWLELTLFIISYIIVGGEVVLRAIKGIARGQVFSEHFLMS
    IATIGAFFIGEYPEGVAVMLFYLVGELFQDIAVGHSRKSISALMDIRPDYANLKVGDEIRKVSPEEVNIGDIIIVKPGEK
    VPLDGKVIEGNSMVDTAALTGESVPREVGPGDDVLSGFINKNGVLTIEVTKDYGDSTVSKILDLVQNASSRKAPTEKFIT
    KFARFYTPIVVFGALALAIIPPLVIPGATFSTWIYRALVFLVISCPCALVISIPLGFFGGIGGASKRGILVKGSNYLDAL
    NNVETVVFDKTGTLTKGVFEVVSINPQSDFTKEELIEYAAYAESHSSHPIALSILKAYNKDVDITKIEDYEEIAGHGIRA
    KVGGKEILVGNSKLMNKENIKYQEVETLGTVVHVAVDKKYAGNIVISDAVKEDSADAIKGLKALGVRNIVMLTGDSKAVG
    EKIATQLGIDEVYTELLPADKVEKIEALEAKKSHKGKIVFVGDGINDAPVLARADIGVAMGGLGSDAAIEAADIVIMTDE
    PSKIVTAIKIAKRTRKIVMQNIVFSLGVKAIFLALGAVGVATMWEAVFADMGVAIIAILNAMRVMNTKSI

    >gi|146295555|ref|YP_001179326.1| redox-active disulfide protein 2 [Caldicellulosiruptor saccharolyticus DSM 8903]
    MVIKVLGGGCANCKKLMENAKKAAEELGIEAQFEEVKDIEKIMSYGVMRTPALVVDEKLILSGRVAGVEEIKEVLKKEAG
    K

    >gi|146295587|ref|YP_001179358.1| thioredoxin-disulfide reductase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MIYDCAVIGAGPAGLSAAINLAQTNRSVIVFATKEEDSAIYKAPEINNYLGFFGVSGKELLRSFYDHAKKYNIEIVNKKV
    INFYKSGNIFTINASNEFYEAYSVILAIGTPKKTLLENEAEFVGRGISY
    CAVCDGMLYKGRVIAVVGESVEAEEEAEYLS
    ELAKKLYYIPLYKKNEFHFKDNVEVILSRPKSVSGQEFVNAIELEDKILSVDGIFIIRKTMPADQLIYGLEFTEEGHIKV
    DKNMQTSIEGLFAAGDCTGRPYQVAKAVGEGLVAGLSASSYVKRIKEALTKKD

    >gi|146295664|ref|YP_001179435.1| NADH dehydrogenase (quinone) [Caldicellulosiruptor saccharolyticus DSM 8903]
    MKIRVGLGSCGMAAGGNKVMECIQQELRSRNLDIPVEPTGCIGLCFFEPLVDVIDGDDVYTYGNVTPEMIPKIIESHVIG
    KKPLDEFIVSTSFEPYPMLKSQVRIALKNCGRINPEDIDDYIKNGGYEALKKVLTSMTPEEVIEEIKISGLRGRGGAGFP
    TWFKWDAARKASGDIKYVVCNADEGDPGAFMDRSILEGDPHAVLEGMTIAAYAIGAKEGYIYVRAEYPLAIKRLEIAIEQ
    ARNRNLLGNNILNTNFSFDIKLKKGAGAFVCGEETALIASIEGERGMPRLKPPFPAQSGLWGRPTNINNVETYANVPWII
    TNGGKAFASLGTEKSKGTKVFALAGKIKRGGLVEVPMGMSLREVIYNIGGGIKDDKAFKAVQMGGPSGGCIPADLIDTPV
    DYESITKTGAIMGSGGMIVMDETTCMVDIARFFLEFTCKESCGKCTYCRVGTRRMLEILDRICNGEGRDGDLELLEELAV
    SVKDGSL
    CGLGQTAPNPVLTTLRYFKDEYIAHIRDKKCPAKQCKALITYSILPEKCTGCGLCARKCPTKAITGERLKPHV
    IDQSKCTKCGTCMNVCRFGAVNVE

    >gi|146295798|ref|YP_001179569.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MRYIVIGAVAGGMTAAMKIRRNDDKAQIVVYDKDTDISYSGCSLAYYISGVIKDRKSIVPRDVEYFKKFNVEVKTSHEVL
    KVDTKTKSVLVKDLSTGNMFEDRFDKLIIATGAQAFIPKIEGINLDGIFTLRNVKDADRIKGYIEKTSPKKTLIIGGGYI
    GLEMAEALSLLGMEVLIVEKQKNILPNLDDDMARLVENYLLQKGIQIRNDSSVLRFEGEGKVKEAVLSDKSKIPADFVLI
    SVGVRPNTEFLKDSGIELLENGAIKVDEYMRTNIEDIFAAGDCAAVYFKLNGKTMYVPLGSTANKMGRIAGENATGGNLR
    FNGILATSIFKVFDLTIAQTGYTEKMARQDEIEYEIGHVTKPHISTAYPGAEKMTIKALAELSSRKIIGAQIVGTKGVDK
    RIDVLATAIYSGLTVDDLFQLDLAYAPPFSSAKDPIHYVGMVMSNLLDEKKFNCTQEKLLQKIKNGEDFVVLDVRTPEQY
    QKKHIKGAINIPLEMIYQKINQLPKDKPIIVY
    CNSGVSSNIAQNILQQNGFRKVCNLSGGILNVTLPELLEGE

    >gi|146295909|ref|YP_001179680.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MKYDLIIIGGGPAGYLAGERAGKNGLKTLLIEKRFLGGVCLNEGCIPSKVLLYSAKVYENAKHGQKYGVEVESIKLNHKM
    VLERKNKVIKTLVTGIKSKLRKNNVEVVDGFAEILGRSKDGYVVKVNKNEYIGDRLLIATGSFPFVPPISGIKEGLEKGY
    VLTNREILELDVIPTSLVVIGGGIVGLEMASYFNSAGSKVTVIEMLDHIGGNMDREISDILLNTYKKKGIEFELSSKVIE
    IKDGKVVYEKDGKLIENSAEKVLLSSGRRPNVEGFGLENIGVEVEKGSIKTDERLKTNVPEVYAAGDVNGKLMLAHTAYR
    EAEVCINNIIGKRDLMRYEAIPSVVYTNPEVAWVGETEESVSQKGLDYEIVKLPMLYSGRFVAENDGFDGLCKILIDKKK
    KTILGCHMIGNYSSEIIYGVALMIEAQMRVDDIKELVFPHPTVSEIIREVIFEL

    >gi|146296080|ref|YP_001179851.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldicellulosiruptor saccharolyticus DSM 8903]
    MLNQRAKNVIFILVVAVLIALLVYQFIPRTKSQVRVNGAVDFKLESVDGKEYSISSFRGKKVILNFFATWCPPCRAEIPD
    FEKFHQNNKDIVLIGVNIQEDKNTVKEFLNSMGVSYLVLLDKDGKIASNFGIEGIPTTFLLDKSGRIIAKNVGMMTYDEL
    DKFVKQNKKD

    >gi|146296121|ref|YP_001179892.1| methylated-DNA--protein-cysteine methyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MLKVLVKRAGEFKLKISIGYLPSPLGLIKIAGQDDSIVSVEFVSHKDEKELISPVVKEAILQLEEYFEGKKTTFELKLQL
    QGTEFQKRVWNELIKVPFRSVISYRELAEKVGKPQGARAVGNAVGKNPAVIIVP
    CHRVVKSDLSLGGFSGGLEKKIWLLS
    HEGWKIENGLLRK

    >gi|146296645|ref|YP_001180416.1| UBA/THIF-type NAD/FAD binding protein [Caldicellulosiruptor saccharolyticus DSM 8903]
    MRLTDTQLERYSRHIILNEVGAKGQQKLLESKVLIIGTGGLGSPAAMFLAAAGVGTIGLVDFDAVELSNLQRQIIHFTPD
    VGKPKVFSAKEKINQMNPDVEVVTYREMVNSRNIIDIIKDRDYDFIIDGTDNFPTKFLINDACVMLKKPFSHAGIIRFDG
    QTMTYVPEKGPCFRCIFQNPPPPDAIPT
    CRQAGVLGVMGGIIGTIQATEAIKYLLGIGELLTGYILIYNALKMEFRKVKI
    NKRESCEVCGKNPTIKELIDYEQPQCDLKG

    >gi|146296734|ref|YP_001180505.1| thioredoxin [Caldicellulosiruptor saccharolyticus DSM 8903]
    MKGAVIKMANNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRI
    MSIPTIMLFKNGQAVDKIIGARPKSDFVNFINRNL

    >gi|146297199|ref|YP_001180970.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor saccharolyticus DSM 8903]
    MKIVIIGGVAAGASAATKARRTNENAQIILFEQGEYVSFANCGLPYYVGGTIPKRESLLVVREELFRKRYNIDVRVLSQI
    TKINRGRKTVTVFDKKNNTTYEESYDKLIIATGARPFVLPFLKDCENSYT
    CFTLYDVDKIKETLTNKLIKKAVVIGAGYI
    GMELAEQLREIGLECTIVELKDSILPQFDKEMTNPILDILKTKGIEVKTGVSVIDAKIENDVAKKLILSNDEEIECDAVF
    QTAGVIPNVELAKEAGLEVNRGIVVNSKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVIGSSIIKVFDRALAKIGLSENECKSLGLDYNVTIVHPLHHAGYYPGGKQLTIKLMFDNKTGKIYGAEIVGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTAANIIRGEVKNILPDRVYDLLDNKGYFILDVRTPEEYEF
    GHIKGAVNIPVDELRGRINELPKDKKIIAY
    CGVGFRSYHACLILKANGFDCLNMSGGWTSWRMYYPDFVE