Caldicellulosiruptor owensensis OL uid60165

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312134095|ref|YP_004001433.1| peroxiredoxin [Caldicellulosiruptor owensensis OL]
    MWKEKISKGEVEMEIINRIPLLGEKFPGMTVKTTHGMIKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKKADEFKKLN
    AELIGLSVDQVFAHIKWVEWIEEKLGVKIPFPVIADELGMVAKTLGMIHEAKGTNTVRAVFIVDDKGVLRLMMYYPQEVG
    RSIDEILRALKALQVSTQNGVALPENWPNNSLIGDKVIIPPAATEDLAKERLQKAKAGEIECFDWWFCYKKL

    >gi|312134274|ref|YP_004001612.1| heavy metal translocating p-type atpase [Caldicellulosiruptor owensensis OL]
    MAKVNVELILENLSCVSCAQKIEEKVAKLPFVESVSLNFVTKKLSAKVDQKFYSAFVETVEKIVNEIEPEVNILVAPKEK
    PMISTGEILSVLISAVFFGVGLFTRKKDFALIFFLVSYLLSGKNIILNFFKNIRKLQLFDENFLMTVATLSAIFLKEYPE
    AVSVMLLYKIGQIFEDVAVNKSRKTIQALKHLEIDYANLKIGNEIRKVNPKDIVPGDIVVVKPGERVPVDGTVVYGKSFL
    DTSAITGESKLFVAQPNDKVFAGSAVVDGVLEVKAQSFYKDSSLHRIIEIVENASTNKSKTERFITRFARVYTPAVVAIA
    VMFAILPPLLFEQPFKLWIYRAAIFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQFIDIFASKTGSFLFDKTGTI
    TNGVLSVEKIVPVQIPEQEFLKILISIESFSNHPIAKSILKGIGENSISFSSVQDVIEHPGKGIQGIADGKKVLIGTKEF
    LQENGVEINNSLELSPELSYIFVSCDMKFCGYVALKDSLKDDVKKVLNDLRNFGAKIYLLTGDKKEVAEKIAKDLPIDGI
    FSELLPEEKVTVAEKIKLENKGTGYVIFVGDGTNDSPALSVCDAGISFAGSASYLATAAADIVLLDEKLSKIVDLIKDSR
    FTRKIVIQNILLSLGIKFSVMLLGVFGVANLWEAVVADTGAMLLAVLNSSRVLKK

    >gi|312134355|ref|YP_004001693.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor owensensis OL]
    MKISIGYLLSPLGLIKIVGQDDSVVSVEFVSHKDEDEVISPVVKEAILQLEEYFEGKRTTFELKLQLQGTEFQKRVWNEL
    IKVPFGSVISYRELAKKVGKPQGARAVGNAVGKNPAVIIVP
    CHRVVKSDGTLGGYSAGIHKKMWLLEHEKITF

    >gi|312134436|ref|YP_004001774.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor owensensis OL]
    MKYIVIGAVAGGMTAAMKIRRNDDKAEIVVYDKDTDISYSGCSLTYYISGVIENRKSIVPRDSQYFKKFNVDVKTAHEVL
    RVDTQNKKVIVRDLITGNIFEDGFDKLIIATGAHPVVPKIDGIELEGIFVLRNVKDADRIKMYINSY
    CPKKALIVGGGYI
    GLEMAEALKVLGMDVVIIEKQENILPNMDSDMARLVENYLEEKEITVKTSTSVLRFEGDKRVTTAILSDGSRLDVDFVLI
    AVGVRPSTQFLEGSGIQLLPNGAIKVDEYMRTNIEGIFAAGDCASVYFKLNGKTIYMPLGSTANKMGRIAGENATGGNLK
    FSGILATSIFKVFDLTVAQTGYTEKTAQQDGIEYEVGHITKPHITTAYPGAEKMTIKALAEVYSRKIIGAQIIGTKGVDK
    RIDVLATAIFAGLTADNLFQLDLGYAPPFSSAKDPIHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFIVLDVRTPEQY
    KIKHIKGAINIPLEMIYEKMSELSREKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGISNITLEELLEENNSDSFTS
    SP

    >gi|312134606|ref|YP_004001944.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor owensensis OL]
    MKYDLIIIGGGPAGYLAAERASKGGLKTLLIEERYLGGVCLNEGCIPTKTLLYSAKILEGAKHGFKYGVEIKNITLNHKK
    VLERKDKVIKTLVTGIKSKLRKSGAEILSGHGEILGRSSKGYIVAVGDKEFATDRLLIATGSSPFVPPIEGVKEALERGF
    VLTNREILEIESVPASMVVIGGGIVGLEMASYFNSAGSKVTVIEMLDHIGGSMDREISNILLETYKKKGVEFELSARVTK
    IDDRKVVYEKDGKFFEKEAEKVLLSVGRRPNITGFGLENIGVELEKGCVKTDDRMKTNVQEVYAAGDINGKLMLAHTAYR
    EAEVAVWNMLGRKVKINYNSIPSVVYTNPEVAWVGESEESAKEKALEYEVVKLPMLYSGRFVAENEDFDGLCKILIDRRK
    RTILGCHMIGNYSSEIIYGVGVMIESQLRVEDIKDIVFPHPTVSEIIREVIFEL

    >gi|312135114|ref|YP_004002452.1| NADH dehydrogenase (quinone) [Caldicellulosiruptor owensensis OL]
    MPLYRSHVLVCGGTGCTSGGSDKIYDAFLKEIEAQNLKDEVQVIHTGCFGLCAEGPIVIVYPEGAFYSKVTDSDVKEIVE
    EHILKGRIVKRLLYKESIEEGQIKSLNEVKFYKKQMRIALRNCGIINPENIEEYIAYDGYKALAKVLTEMTPEQVIDWVK
    RSGLRGRGGGGFPTGLKWEFAAKAPGDVKYVVCNADEGDPGAYMDRSILEGDPHSVIEAMAIAGYAIGSKQGYVYVRAEY
    PLAVKRLEIAINQAREYGLLGKNILGTDFEFDIEIRLGAGAFVCGEETALMTSIEGHRGEPRPRPPFPAVKGLWGKPTLL
    NNVETYANIPVIILKGPEWFASIGTEKSKGTKVFALVGKVNNTGLIEVPMGTTVREIVEDIGGGIPGGKKFKAVQTGGPS
    GGCIPASLIDTPIDFDSLTALGTMMGSGGMIVMDEDTCMVDIAKFFLEFTVDESCGKCPPCRIGTRRMLEILQKITTGNG
    TEEDLEKLEELAYSIKDSAL
    CGLGQTAPNPVLSTLRYFRDEYEAHVKEKRCPAGACKALLRIVIDKDLCKGCGICAKNCP
    ANAITGQIKKPFEIDQSKCIKCGVCIEKCPFKAISKKA

    >gi|312135318|ref|YP_004002656.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor owensensis OL]
    MKIVIIGGVAAGASAATKARRTNENAQIVLLEQGEYVSFANCGLPYYVGGTIPKRDNLLVVREELFRKRYNIDVRTLSQV
    TKINRSKKTVTVLDKRNNTTYEESYDKLIIATGARPFVLPFLKDCKNSYTCFTLYDVDKIKEAFSADPVKKAVVIGAGYI
    GMELAEQLNLLGVECTIIELKSSILPQFDKEMTNPVVDTLKEKGVDVKTGVSVVDADVIDGVAKRLKLSNGEEIECDVVF
    QTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVVGSSIIKVFDWALAKVGLSETECKDQGLNYNVTIVHPLHHAGYYPGGKQLTIKLIFDSTTGRIYGAQVIGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNILRGEVKNILPDRVFELLDNPDYIVLDVRTPEEYEF
    GHVKGAVNIPVDELRNRVSELPKDKKIIVY
    CGVGFRSYHGCLILKANGFDCLNMSGGWTSWRMYYPDMVE

    >gi|312135383|ref|YP_004002721.1| thioredoxin [Caldicellulosiruptor owensensis OL]
    MANNIVTLTSENFEKEVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKDGKAVDKIIGARPKSDFVNFINRNL

    >gi|312135622|ref|YP_004002960.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Caldicellulosiruptor owensensis OL]
    MLNNRSKSVIFILTSAILIGLLVYQIMSHSRENAAADGIVNFKLVSVDGKEFSLSDFRGKKVLLNFFATWCPPCRAEIPD
    FERFHRENKDVVLIGINIQEDKATVEEFLSLMGVTYPVLLDRDGKVSAQFGIEGIPTTFLIDENGKIVAKNVGMMTYEQL
    KKFAGK

    >gi|312135962|ref|YP_004003300.1| copper ion binding protein [Caldicellulosiruptor owensensis OL]
    MTKKIYIKGMTCDHCVRRVENSIKAIEGVSSVKVDLQGKVATVELSKDVKDEEFVRAIDDAGYEVARIE

    >gi|312135963|ref|YP_004003301.1| heavy metal translocating p-type atpase [Caldicellulosiruptor owensensis OL]
    MKKKVLSVTGMTCASCARAIEKSVSKIEGVTNASVNFATEKLIVEFDESKASIEKIKEAEERAGYGVLDDGEETIREVSI
    PISGMT
    CASCARAIEKSISKLNGIREVSVNLASEKARVVYDSSQVRLSEIKNAIIKAGYTPLEIEKTSYEDSHQERKQKE
    INSLFRRFIIASIFAVPLLLIAMAHVVGLPLPEIISPEKYPLNFALVQAILAVPVVIAGYKFYTVGFRRLFKFHPNMDSL
    IAVGTGAAFLYGLFAMYQIAKGNYQYAEEMYFETAGVIIALVLLGKYLEAVSKGKASEAIKKLMGLAPKTAVVIQGDNEV
    VIPIEEVEVGDILLVKPGENIPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIRATKVGKDTVIAQ
    IIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISAIAWYFLSDSFTFALRIFITVLVIACPCALGLATPTAVMVATG
    KGAEHGILIKRSEALETLHKVTTIVFDKTGTITEGKPKVTDIIPANGWERERLLQIVASAERLSEHPLGEAIVAAAKEKN
    LQLHEASQFEAISGHGIEAVVDGQKILVGNEKLMQDKGVEIGFLLDVEKLSQQAKTPMFVAINGKFAGIIAVSDLIKTNA
    KRAIELLHNMGIEVVMITGDNSKTANAIAQLVGIEKVLANVLPQDKANKVKELQKQGKKIAMVGDGINDAPALAQADVGI
    AVASGTDVAAEAADVVLMKDDILDVVNAILLGKKTIQNIKQNLFWAFFYNTLGIPVAAGVLHIFGGPLLNPMIAAFAMAL
    SSVSVVSNALRLKRFKPVKIIKN

    >gi|312136140|ref|YP_004003478.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor owensensis OL]
    MKMIYDCAVIGAGPAGLSAAINLAQTNRSVVVFATKEEDSSIYRAPEVNNYLGFHGVSGKELLQAFYDHAKKMGIEIVHK
    KVINFYKSGDVFTINANNEFYEAYSVILAIGTPKKTLLENEAEFVGRGISY
    CAVCDGMLYKGRTIAVIGEAIEAEEEAEY
    LSELAKKLYYVPLYKKNEFHFKDNVEVIFSRPKGVYGEDFVNALELEDRILNVDGVFIIRKTMPADQLIYGLEFTEDGHI
    KVDSKMQTSIEGLFAAGDAVGRPYQVAKAVGEGQIAGLSASTYVKMVKEKQK

    >gi|312136164|ref|YP_004003502.1| redox-active disulfide protein 2 [Caldicellulosiruptor owensensis OL]
    MVIKVLGGGCANCKKLMENAKKAAEELEIQASFEEVKDIEKIMSYGVMRTPALVVDEKLIFSGRVAGVEEIKEVLKKEAG
    K