Caldicellulosiruptor obsidiansis OB47 uid51501

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302870744|ref|YP_003839380.1| Peroxiredoxin [Caldicellulosiruptor obsidiansis OB47]
    MEITNRIPLLGEKFPSMTVKTTHGMIKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKKADEFKKLNAELIGLSVDQVF
    AHIKWIEWIEEKLGVKIPFPVIADELGTVAKTLGMIHEAKGSNTVRAVFIVDDKGILRLMMYYPQEVGRSIDEILRALKA
    LQVSTQNGVALPENWPNNSLIGDKVIIPPAATEDLAKERLQKAKDGEIECFDWWFCYKKL

    >gi|302870976|ref|YP_003839612.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor obsidiansis OB47]
    MNVELILENLSCANCAQKIEEKVAKLPFAESVSLNFVTKKLSAKVDQKSYSAFVEAVKKIVNEIEPEVSVLEAPKEKPMI
    SIGEILLVLISAMFFVVGLFTRKEGFALIFFLVSYLLSGKNVILSFFKNIRKLQLFDENFLMTVATLSAIFLKEYPEAAS
    VMLLYKIGQILEDVAVNKSRKTIQALKHLEIDYANLKIGNIIRKVNPKDIVPGDIVVVKPGERVPVDGTVVSGKSFLDTS
    AITGESKLFVAQPNDKVFAGSAVVDGFLEVKAQSFYKDSSLHRIIEIVENASANKSKMERFITRFAKVYTPAVVALAVIF
    AILPPLLFDQPFKLWIYRAAIFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQFIDILASKIGSFLFDKTGTITNG
    VLSVEKIVPVQISEQEFLKILISIESLSNHPVAKSILKGIGENSISFSSVQDLKEHPGRGIEGIVDGKKVLIGTKEFLQE
    SGVEINHSSEVSSELSYIFVSCDMKFCGYVALKDSLKDDVKKVLNALKSFGAKIYLLTGDKKEVAEKIAKDLPIDGIFSE
    LLPEEKVKVAEKIKLENKGLGYVVFVGDGTNDSPALSVCDVGISFAGSASYLATVAADIVLLDGKLSKIVELIKDSRFTR
    RIVIQNIVLSLGIKFAVMLLGVFGVANLWEAVVADTGAMLLAVLNSLRVLKK

    >gi|302871095|ref|YP_003839731.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor obsidiansis OB47]
    MKISIGYLLSPIGLIKIVGQDNSIVSVKFVSHKDEDELISPVIKEAILQLKEYFEGKRTSFELKLQLQGTEFQKRVWNEL
    IKIPFGCVISYKELAKRVGKTQGARCVGNAVGKNPAVIVVP
    CHRVVKSDLALGGFSGGLEKKIWLLSYEGWKIENGLLIK


    >gi|302871151|ref|YP_003839787.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor obsidiansis OB47]
    MKYIVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLTYYISGVIDNRKNIVPRDSQYFKKFNVDVKTAHEVL
    KVDTQNKKVIVKDLTTGNTFEDGFDKLIIATGAHPVVPKIDGIELEGIFVLRNVKDADRIKEFINTYFPKKALIVGGGYI
    GLEMAEALKVLGIDVVIIEKQENILPNLDSDMARLVENYLKEKGITVKTSTSVLKFEGDKRVTTAILSDGSRLNVDFVLI
    AVGVRPSTQFLEGSGIQLLPNGAIKVDEYMRTNIEGIFAAGDCASVYFKLNGKTMYMPLGSTANKMGRIAGENATGGSMK
    FSGILATSIFKVFDLTVAQTGYTEKMAQQDGIEYEVGHVTKPHITTAYPGAEKMTIKAIAELSSRKIIGAQIIGTKGVDK
    RIDILATAIFAGLTTDHLFQLDLAYAPPFSSAKDPVHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFVVLDVRTPDQY
    KIKHIKGAVNIPLEMLQEKMNLLPKDKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGILNVTLEQLLERNTSDSSPS
    SPDL

    >gi|302871317|ref|YP_003839953.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor obsidiansis OB47]
    MKYDLIIIGGGPAGYLAAERASKGGLKTLLIEERYLGGVCLNEGCIPTKTLLYSAKILEGAKHGFKYGVEVKDITLNHKK
    VLERKDKVIKTLVTGIKSKLRKSGAEILSGHGEILGRSSKGYIVAVGDKEFATDRLLIATGSSPFIPLIEGVKEALERGF
    VLTNREILEIESVPASMIVIGGGIVGLEIASYFSSAGSKVTVIEMLDHIGGSMDREISNILLEIYKKKGVEFELSARVTK
    IDEGKVVYEKDGKFFEKEAEKVLLSVGRRPNITGFGLENIGVELEKGCVKTDDRMKTNVQEVYAAGDINGKLMLAHTAYR
    EAEVAVWNILGRKVKVNYNSIPSVVYTNPEVAWVGESEESIKGKGLEYEVIKLPMLYSGRFVAENEEFDGLCKILIDKRK
    RTILGCHMIGNYASEIIYGVGIMIEMQLRVEDIKDIVFPHPTVSEIIREVIFEL

    >gi|302871611|ref|YP_003840247.1| thioredoxin [Caldicellulosiruptor obsidiansis OB47]
    MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKNGKAVDKIIGARPKSDFVNFINRNL

    >gi|302871682|ref|YP_003840318.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor obsidiansis OB47]
    MTYKIKITDRKGNCKQMKIVIIGGVAAGASAATKARRTNENAQIVLLEQGEYVSFANCGLPYYVGGTIPKRDSLLVVREE
    LFRKRYNIDVRTLSQVTKINRSKKTVTVLDKRNNTTYEESYDKLIIATGARPFVLPFLKDCKNSYT
    CFTLYDVDKIKEAF
    SAAPVKKAVVIGAGYIGMELAEQLNLLGVDCTIVELKSSILPQFDKEMTNPVVYTLKEKGVDVKTGVSVVDADVIDGVAK
    RLKLSNGEEIECDVVFQTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANK
    QGRVAGCNAAGGNLEFKGVVGSSIIKVFDWALAKVGLSETECKDQGLNYNVTIVHPLHHAGYYPGGKQLTIKLIFDSTTG
    RIYGAQVIGKEGVDKRADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNIIRGEVKNILPDRVFEHLDN
    PDYIILDVRTPEEYEFGHIKGAVNIPVDELRNRLSELPKDKKIIVY
    CGVGFRSYHGCLILKANGFDCLNMSGGWTSWRMY
    YPDMVE

    >gi|302871901|ref|YP_003840537.1| NADH dehydrogenase (quinone) [Caldicellulosiruptor obsidiansis OB47]
    MPLYRSHVLVCGGTGCTSGGSDKIYDAFLKEIEAQNLKDEVQVIRTGCFGLCAEGPIVIVYPEGAFYSKVADSDVKEIVE
    EHLLKGRIVKRLLYKESVEEGQIKSLNEVKFYKKQMRIALRNCGLINPENIEEYIAYDGYKALAKVLTEMTPEQVIDWVK
    RSGLRGRGGGGFPTGLKWEFAAKAPGDVKYVVCNADEGDPGAYMDRSILEGDPHSVIEAMAIAGYAIGSKQGYVYVRAEY
    PLAVKRLEIAINQAREYGLLGKNILGTDFEFDIEIRLGAGAFVCGEETALMTSIEGHRGEPRPRPPFPAVKGLWGKPTLL
    NNVETYANIPVIILKGPEWFASIGTEKSKGTKVFALVGKVNNTGLIEVPMGTTVREIVEDIGGGIPGGKKFKAVQTGGPS
    GGCIPASLMDTPIDFDSLTALGTMMGSGGMIVMDEDTCMVDIAKFFLEFTVDESCGKCPPCRIGTRRMLEILQKITSGNG
    TEEDLEKLEELAYSIKDSAL
    CGLGQTAPNPVLSTLRYFRDEYEAHVKEKRCPAGACKALLRIVIDKDLCKGCGICAKNCP
    ANAITGQIKKPFEIDQSKCIKCGVCIEKCPFKAISKKA

    >gi|302872335|ref|YP_003840971.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldicellulosiruptor obsidiansis OB47]
    MLNNRSKSVIFILISAILIGLLVYQIMSHSKEKAATDGVDFRLLAVDGKEYSLLDFRGKKVLLNFFATWCPPCRAEIPDF
    ERFHRENKDVVLIGINIQEDKATVEEFLSSMGVTYPVLLDRDGKVSAQFGIEGIPTTFLIDKNGKIVAKNVGMMTYEQLK
    KFAGK

    >gi|302872654|ref|YP_003841290.1| copper ion binding protein [Caldicellulosiruptor obsidiansis OB47]
    MTKKIYIKGMTCDHCVRRVENSLKAIEGVSSVKVDLQGKVATVELSKDVKDDEFVRAIDDAGYEVTKIE

    >gi|302872655|ref|YP_003841291.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor obsidiansis OB47]
    MKKKVLSVTGMTCTSCAKAIEKSVSKVEGVANVSVNFATEKLIVEFDESKASIEKIREAVKRAGYGVLDDREETIREVTV
    PISGMT
    CASCARAIEKSISKLNGIKEVSVNLASEKARVVYDSSQVRLSEIKNAIIKAGYTPLEIEKTSYEDSHQERKQKE
    INSLFRRFVIASVFAVPLLLIAMAHVVGLPLPEIISPEKHPLNFALVQAILVIPIVIVGYKFYTVGFSRLLKLQPNMDSL
    IATGTSAAILYSIFAIYQIAMGNYQYVKEMYFETAGVIITLVLLGKYLEAFSKGKASEAIKKLMGLAPKTAVVIQGDNEV
    VIPIEEVETGDIILVKPGEKIPVDGEVIEGRSFVDESMITGESIPVEKTPGSKVIGATINKNGMLKVKATNVGKDTVIAQ
    IIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISALVWYFTGSSFIFALRIFITVLVIACPCALGLATPTAIMVSTG
    KGAEHGILIKSGGALETLHKITMVVFDKTGTITEGKPRVTDIIPANGWKRERLLQIAASAERLSEHPLGEAIVFAAKENN
    LQLFEASQFEAISGYGIEAVINGQKVLVGNKKLMKDKGIEIDSLLDIEKLSQQAKTPIFVAQNGEFAGIIAVSDVIKPNA
    KRAIELLYSMGIEVAMITGDNEKTAKAIAKQVGIDNILADVLPQDKANEIKKLQRKGKKVAMVGDGINDAPALAQADVGI
    SIASGTDVAAEAADVVLMKDDILDVVNAILLSKKTIQNIKQNLFWAFFYNILGIPIAAGFLHVFGGPLLNPMIAAFAMAL
    SSVSVVSNALRLKRFKPVK

    >gi|302872708|ref|YP_003841344.1| aldo/keto reductase [Caldicellulosiruptor obsidiansis OB47]
    MKYRKFPNIDLEVSALGFGCMRLPIIGEDSSQIDESLAIKMIRHAIDNGVNYIDTAYGYHGGNSEIVVGKALKGGYRNKV
    NLATKLPVWKLTKIEDADILLDEQLKKLDTDHIDFYLLHALNKQRWDMLKNMNIFSWIEKIKSQGKIKHIGFSFHDSLDT
    FKLIIDEYEGWEFCQIQYNYLNRNYQAGEEGLKYAYAKGLGVIIMEPLLGGKLARKPPEEVQKVWEKAKIKRSPAQWGLL
    WLWNQKEVTTVLSGMSSIQQVIENIETADQGYVGCLSDEELKLIDEVTKKYLELKPIDCTG
    CKYCLPCPNGVDIPRNFNL
    YNDAKVYNMYEEAKKTYLKPDKEQQKASNCVECGMCEEKCPQNLPIRKLLKEVVQFFEG

    >gi|302872806|ref|YP_003841442.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor obsidiansis OB47]
    MKMIYDCAVIGAGPAGLSAAINLAQTNRSVVVFVTKEEDSSIYRAPEVNNYLGFHGVSGKELLQAFYDHAKKMGIEIVHK
    KVINFYKSGDIFTINANNEFYEAYSVILAIGTPKKTLLENESEFVGRGISY
    CAVCDGMLYKGRTIAVIGEAIEAEEEAEY
    LSELAKKLYYVPLYKKNEFHFKDNVEVIFSRPKGVYGEDFVNALELEDRILNVDGIFVIRKTMPADQLIYGLEFTEDGHI
    KVDSKMQTSIEGLFAAGDCTGRPYQVAKAVGEGLIAGLSASTYVKAVKEKQNKKD

    >gi|302872831|ref|YP_003841467.1| redox-active disulfide protein 2 [Caldicellulosiruptor obsidiansis OB47]
    MVIKILGGGCANCKKLMENAKKAVEELGIQASFEEVKDIQKIMSYGVMRTPALVVDEKLIFSGRVAGVEEIKEVLKKEAG
    K