Caldicellulosiruptor kronotskyensis 2002 uid60491

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312621144|ref|YP_004022757.1| peroxiredoxin [Caldicellulosiruptor kronotskyensis 2002]
    MENINRIPLLGEKFPSMTVKTTHGMKKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKKAEEFKKLNAELIGLSVDQVF
    AHIKWIEWIEEKLGVKIPFPVIADELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKA
    LQTSDQNGVATPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKAGEIECFDWWFCYKKL

    >gi|312621338|ref|YP_004022951.1| aldo/keto reductase [Caldicellulosiruptor kronotskyensis 2002]
    MKYRKFPNIDFEVSALGFGCMRLPILGDDASQINQPLAIEMIRYAIDNGVNYIDTAYGYHGGNSEVVVGKALKEGYRNKV
    KLATKLPVWKLTKIEDADMILDEQLKRLDTDYIDFYLLHALNKQRWDMLKSMDIFSWIEKVKSKGKIKHIGFSFHDSLDT
    FKTIIDEYDGWEFCQVQYNYLNRNYQAGEEGLKYAHAKGLGVIIMEPLLGGKLARKPPEQVQIVWEKTKVKRTPAQWGLL
    WLWNQKEVTTVLSGMSSMQQVIENIKTADEGYVGCLSEDELKLIDEVTQKYLELKPIDCTGCKY
    CLPCPNGVDIPRNFNL
    YNDAKVYNMYEETKKAYLKPEKVEQKASNCVECSLCEEKCPQNLPIRKLLKEVAQFFEG

    >gi|312621366|ref|YP_004022979.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kronotskyensis 2002]
    MIYDCAVIGAGPAGLSAAINLAQTNRSVVVFATKQEDSSIYRAPEVNNYLGFHGVTGKELLQSFYDHAKKMGIEIIYKKV
    INFYKSGDIFTINANNEFFEAYSVILAIGTPKKTLLENESEFVGRGISY
    CAVCDGMLYRGRDIAVIGESEEAEEEAEYLS
    ELAQKVYYIPLYKKNKFHFKDNVEIVLARPKGVYGEDFVNALELEDRILNVDGVFIIRKTMPADQLIYGLEFTEDGHIKV
    DSKMQTSIEGLFAAGDVVGRPYQVAKAVGEGQIAGLSASTYVKMVKEKQK

    >gi|312621459|ref|YP_004023072.1| heavy metal translocating p-type atpase [Caldicellulosiruptor kronotskyensis 2002]
    MKKTLSITGMTCSSCARAIEKSVSKLEGVSSASVNFATEKLIVEFDENKASIEMIREAVERAGYGVLDDEEATIREVTIP
    ISGMT
    CASCARAIEKSISKLNGIKEVSVNLASEKAKVVYDSSKLRLSEIKNAIIKAGYTPLEIEKTYYGDLHQERKQKEI
    NNLFRRFVIASIFAVPLLLIAMAHLVGLPLPEIILPEKHPLNFALVQAILAIPIVIAGYKFYTVGFSRLFKFHPNMDSLI
    AVGTGAAFLYGLFAIYQIAIGHYQYVKELYFETAGVIIALVLLGKYLETVSKGKASEAIKKLMGLAPKTAVVIQGDNEIV
    IPIEEVEVGDILLVKPGEKIPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIAQI
    IKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISATAWYFAGSSFIFALRIFITVLVIACPCALGLATPTAIMVSTGK
    GAEHGILIKSGDALETLHKITMVVFDKTGTITEGKPKVTDIIPANGWERKRLLQIVASAERFSEHPLGEAIALAAKEKNL
    KLFDVSQFEAISGHGIEAVVDGQTVLVGNEKLMKDKGIEIDFLLDVEKLSQQAKTPMFIALNGKFAGIIAVSDVIKPNAK
    RAIELLHSMGIEVAMITGDNSKTAKAIAKQVGIDRVLAEVLPQDKANEVKKLQGEGKKVAMVGDGINDAPALAQADVGIA
    IGSGTDVAIESADVVLMKSDILDVVNAILLSKKTIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAALAMAFS
    SVSVVSNALRLKRFKPVN

    >gi|312621460|ref|YP_004023073.1| copper ion binding protein [Caldicellulosiruptor kronotskyensis 2002]
    MTKKIYIKGMTCDHCVRRVENNLKAIEGVTSVQVDLQEGVATVDLSKDVKDEEFVRAIDDAGYEVVRIE

    >gi|312621905|ref|YP_004023518.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Caldicellulosiruptor kronotskyensis 2002]
    MLNNRIKSVIFILISAILIGLLVYQIMSRSKENAAAEGIVNFKLVSVDGKEYSLSDFRGKKVVLNFFATWCPPCRAEIPD
    FERFHRENKDVVLIGINIQEDKATVEEFLSSMGITYPVLLDRDGKVSAQFGIEGIPTTFLIDENGRIIAKNVGMMTYEQL
    KKFAGK

    >gi|312622172|ref|YP_004023785.1| thioredoxin [Caldicellulosiruptor kronotskyensis 2002]
    MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKNGRAVDKIIGARPKSDFVNFINRNL

    >gi|312622258|ref|YP_004023871.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kronotskyensis 2002]
    MKIVIIGGVAAGASAATKARRTSEHAQIVLFEQGEYVSFANCGLPYYVGGTIPKRDSLLVVREELFRKRYNIDVRTLSQV
    MKINRNRKTVTVLDKRNNTTYEESYDKLIIATGARPFVLPFLKDCKNSYTCFTLYDVDKIKETLSAAPVKKAIIIGAGYI
    GMELAEQLNLLGLDCTIVELKSSILPQFDKEITNPVVYTLKEKGIDVKTGVSVVDADVVDGIAKRLKLSNGEEIECDVVF
    QTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVVGSSIIKVFDWALAKVGLSEAECKDQGIDYNVTIVHPLHHAGYYPGGKQLTIKLIFDNSTGRIYGAQVVGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNIIRGEVKNILPDRVFELLDNPEYLILDVRTPEEYEF
    GHIKRAINIPVDELRNRLSELPKDKKIIVY
    CGVGFRSYHGCLILKANGFDCLNMSGGWTSWRMYYPDMVE

    >gi|312622465|ref|YP_004024078.1| NADH dehydrogenase (quinone) [Caldicellulosiruptor kronotskyensis 2002]
    MPLYRSHVLVCGGTGCTSGGSDKIYDAFIKEIEEQNLKDEVQVIRTGCFGLCAEGPIVIVYPEGAFYSKVADSDVKEIVE
    EHLLKGRIVKRLLYKESIEEGQIKSLNEVKFYKKQMRIALRNCGVINPENIEEYIAYDGYKALAKVLTEMTPEQVIDWVK
    RSGLRGRGGGGFPTGLKWEFAAKAPGDVKYVVCNADEGDPGAYMDRSILEGDPHSVIEAMAIAGYAIGSKQGYVYVRAEY
    PLAVKRLEIAIEQARQYGLLGKNILGTGFEFDIEIRLGAGAFVCGEETALMTSIEGHRGEPRPRPPFPAVKGLWGKPTLL
    NNVETYANIPVIILKGPEWFASIGTEKSKGTKVFALVGKVNNTGLIEVPMGTTVREIVEDIGGGIPGGKKFKAVQTGGPS
    GGCIPASLMDTPIDFDSLTALGTMMGSGGMIVMDEDTCMVDIAKFFLEFTVDESCGKCPPCRIGTRRMLEILQKITSGNG
    TEEDLEKLEELAYSIKDSAL
    CGLGQTAPNPVLSTLRYFRDEYEAHVKEKRCPAGACKALLRIVIDKDLCKGCGICAKNCP
    ANAITGQIKKPFEIDQSKCIKCGVCIEKCPFKAISKKA

    >gi|312622574|ref|YP_004024187.1| uba/thif-type nad/fad binding protein [Caldicellulosiruptor kronotskyensis 2002]
    MKLTDTQLERYSRHIIMNEVGVKGQQKLLESKVLIIGTGGLGCPAAMFLAAAGVGTIGLVDFDAVELSNLQRQIIHFTPD
    IGKPKVFSAKEKINQMNPDVEVVTYREMVNSSNIIDIIKDRDYDFIIDGTDNFPAKFLINDACVILKKPFSHAGIIRFDG
    QTMTYVPEKGPCFRCIFQNPPPPDAVPT
    CRQAGVLGVMGGIIGTIQATEAIKYLLGIGDLLTGYILIYNALKMEFRKIKI
    NKRESCEVCGKNPTIKELIDYEQPQCDLKG

    >gi|312622977|ref|YP_004024590.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor kronotskyensis 2002]
    MKYDLIIIGGGPAGYLAAERASKGGLKTLLIEERYLGGVCLNEGCIPTKTLLYSAKILEGAKHGFKYGVEVKNITLNHKK
    VLERKDKVIKTLVTGIKSKLRKSGAEILSGHGEILGRNSKGYIVAVGDKEFATDRLLIATGSSPFIPPIEGMKEGLQRGF
    VLTSREMLEIESVPASMVVIGGGIVGLEMASYFNSAGSKVTVIEMLDYIGGSMDREISNILLEAYKKKGIEFELSARVIK
    IDDRKVVYEKDGKIFEKEAEKVLLSVGRRPNITGFGLENIGVEVEKGCVKTDERMKTNVQEVYAAGDVNGKLMLAHTAYR
    EAEIAVWNMLGRRVKVNYDSIPSVVYTNPEVAWVGESEESAKEKGLEYEVAKLPMLYSGRFVAENEEFDGLCKILIDRKK
    RTILGCHMIGNYSSEIIFGVGVMIEAQLRVEDIKDIVFPHPTVSEIIREVIFEL

    >gi|312623149|ref|YP_004024762.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kronotskyensis 2002]
    MKYVVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLAYYISGVIDNRKNIVPRDSQYFKKFNVDVKTDHEVL
    KVDVQNKKVIVKDLKTGNIFEDGFDKLIIATGAHPVIPQIEGIELEGIFVLRNVKDADRIKEFINNNLPKKALIVGGGYI
    GLEMAEALKVLGMDVCIVEKQKNILPNLDSDMARLVESYLEENGVVIRKGTSVLRFEGDKRVKRAILSDGSKIEADFVLL
    AVGVRPSTKFLEESGIQLLPNGAIKVDEYMRTNIEGIFAAGDCAAVYFKLNGKTMYVPLGSTANKMGRIAGENATGGSMK
    FSGVLATSIFKVFDLTVAQTGYTEKMAQEDGIEYEVGHITKPHITTAYPGAEKMTIKALAELSSRKVIGAQIVGTKGVDK
    RIDVLATAIFAGLTTDDLFQLDLAYAPPFSSAKDPIHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFIVLDVRTPEQY
    KAKHIKGAINIPLEMLHEKMNELSREKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGISNVTIKQLIE

    >gi|312623223|ref|YP_004024836.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor kronotskyensis 2002]
    MKKSVGYLISPIGLIKIVGQDDSIVSVEFVSRKDEKELISPVIKEAILQLEEYFGGKRTNFELKLRLEGTEFQKRVWNEL
    INVPFGSVVSYRELAKKVGKPHGARAVGNAAKKNPAVIIVP
    CHRVIKNDGTLGGYSAGIDKKIWLLEHERVTF

    >gi|312623337|ref|YP_004024950.1| heavy metal translocating p-type atpase [Caldicellulosiruptor kronotskyensis 2002]
    MSKVNVELILENLSCANCAQKIEEKVAKLSFAEDVSLNFVTKKLSAKVDQNYHEIFIESVKKIVNEIEPEVRVLVAPKEK
    SILNIGDISALVISSIFFGIGVLTKRENFALIFFILSYFLSGKSVILNFFKNLRKFQVFDENFLMTVATLSAILLKEYPE
    AASVMLLYKIGQILEDVALNKSRKTIQALKHLEIEYANLKIGNSIRKVNPKDIVPYDIVVVKPGERVPVDGIVVSGKSFL
    DTSAITGESKLFAVQPNDKVLAGSVVVDGFLEVKAQSFYKDSALHRIVEIVENASVNKSKTEKFITRFAKVYTPSVVIIA
    IILAILPPLLFDQPFSLWIYRAAIFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQYIDILASKIGSFLFDKTGTI
    TNGTLSVEKIVPVEISQQEFLKILISIESLSNHPIAKSILSQVEQKDISLSSVQELKEHPGRGIEGIVEGKKVLIGTKEF
    LQENGVKIEYSFEKSPEFLYIYVSCEGKFCGYVALKDSLKDDVKKVFNRLKSLGSKIYILTGDKKEAAEKIVKDLPIDGI
    YSELLPEEKVRIAEKIKLENKELGYVVYVGDGTNDSPVLSVCDVGISFVKNSSYLATLAADIVLLDEKLYKIVDLIKDSR
    FTRKIVIQNIVLSLGIKFAVMFLGILGVANLWEAVVADTGAMLLAVLNSLRVLKR

    >gi|312623486|ref|YP_004025099.1| redox-active disulfide protein 2 [Caldicellulosiruptor kronotskyensis 2002]
    MVIKVLGGGCANCKKLMENAKKAAEELGIEAHFEEVKDIEKIMSYGVMRTPALVVDEKLIFSGRVTGVEEIKEILKKEAG
    K