Caldicellulosiruptor kristjanssonii 177R1B uid60393

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312792336|ref|YP_004025259.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kristjanssonii 177R1B]
    MIVLKYTLYGYNNIGVKLRMIYDCAVIGAGPAGLSAAINLAQTNRSVVVFTTKEEDSSIYRAPEVNNYLGFHGVSGKELL
    QAFYDHAKKMGIEIVHKKVINFYKSGDIFTINANNEFYEAYSVILAIGTPKKTLLENEAEFVGRGISY
    CAVCDGMLYKGR
    TIAVIGEAIEAEEEAEYLSELAKKLYYVPLYKKNEFHFKDNVEVILSRPKSVYGEDFVNALELEDRILNVDGIFIIRKTM
    PADQLIYGLEFTEDGHIKVDSKMQTSIEGLFAAGDCTGRPYQVAKAVGEGQIAGLSASTYVKMVKEKQK

    >gi|312792439|ref|YP_004025362.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kristjanssonii 177R1B]
    MRYVIIGASAAGINCAKTLRNLDNNADIAVISKDNKIYSRCLLPEFIGGKKDFDKMSFINENFFEENNINWIKNTTIKNI
    QASKKRIVCCDGRTYEYDKLLIATGSCPVVPPIDGLNEALKTGKVFVLRDIEDAINIKEAAKYSKSAVVVGGGFIGLQVA
    ENLREYGILVFVVEMKDHILPQQLDKKAAKRYEALFKKHGVRIVTGEVVKQIIYSERQNTIGLILSNGDFIYTDMLVIAS
    GVRPSFPDIEEGKVKIEHGIIVDEYQRTDDPDIFAAGDVCQSYETFSGSYRVAPIWPLAVKQGQIAGYNMAGFCKPMENN
    FGFKYSMKFFGIPTISYGYPEAPDNTYEVVALEGEDYYYKVIYKDGILYGAIIQGDIVGAGVMGKLIEGKYNLSKKLDKG
    DLSKIFSLSYGDFFSEKADGSFEFVV

    >gi|312792528|ref|YP_004025451.1| heavy metal translocating p-type atpase [Caldicellulosiruptor kristjanssonii 177R1B]
    MAKVNVELILENLSCAHCAQKIEEKVVKLPFAESVSLNFVTKKLSAKVEQKSYSAFVEAVKRIADEIDPGVSVLEAPKEK
    PMLNRGEILLVVISAAFFGAGLLTRKEGFALIFFLVSYLLSGKNVILSFFKNLRKLQVFDENFLMTVATLSAIFLKEYPE
    AASVMLLYKIGQILEDVALNKSRKTIQALKHLEIDYANLKIGNSIRKVNPKDIVPGDIVVVKPGERVPVDGTVVSGKSFL
    DTSAITGESKLFAAGPNDKVLAGSVVVDGFLEIRAQSFYKDSSLHRIIEIVENASANKSKMERFITRFAKVYTPVVVALA
    TAFAILPPLLFDQPFKLCIYRAAIFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQFIDILASKIGSFLFDKTGTI
    TNGVLSVEKIVPVGISQQEFLKILISIESLSNHPIAKSILKGIGENSISFSSVQELKEHPGKGIEGIVDGKKVLIGTKEF
    LQENGVEIDHSSEVSPELSYIFVSCDQKFCGYVALRDSLKDDVKKVLNDLKSFGAKIYLLTGDKKEAAEKIAKRLPIDGV
    FSELLPEEKVRVAEKIKLENKEQGYVVFVGDGTNDSPALSVCDVGISFAGSASYLATVAADIVLLDEKLSKIVDLIKDSR
    FTRKIVIQNIVLSLGIKFAVMFLGVLGVANLWEAVVADTGAMLLAVLNSLRVLKK

    >gi|312792777|ref|YP_004025700.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kristjanssonii 177R1B]
    MKYIVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLAYYISGVIDNRKSIVPRDSQYFKKFNVDVKTAHEVL
    KVDVQNKKVIVRDLGTGNIFEDSFDKLIIATGAHPVIPQIDGAHLEGIFVLRNVKDADRIKEFINTYFPKKALIVGGGYI
    GLEMAEALKVLGMDVCIVEKQENILPNLDSDMARLVESYLEQKGVMIKKSTSVLRFEGDKRVKRAILSDGSKMDIDFVLL
    AVGVRPSTQFLEGSGIQLLPNGAIKVDEYMRTNIEGIFAAGDCASVYFKLNGKTMYVPLGSTANKMGRIAGENATGGSMK
    FSGILATSIFKVFDLTVAQTGYTEKMAQQDEIEYEVGHITKPHITTAYPGAENMTIKAIAELSSRKIIGAQIVGTKGVDK
    RIDVLATAIFAGLTTDDLFQLDLAYAPPFSSAKDPVHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFVVLDVRTPDQY
    KIMHIKGAVNIPLEMLQNKMNLLPKDKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGISNVTLEQLLERSTSNSSPS
    SP

    >gi|312793015|ref|YP_004025938.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Caldicellulosiruptor kristjanssonii 177R1B]
    MLNNRIKSVIFILISAILIGLLVYQIMSRSKENRALESAVNFKLVSVDGKEYSLSDFRGKKVVLNFFATWCPPCRAEIPD
    FERFHRENKDVVLLGINIQEDKATVEEFLSSMGVTYPVLLDRDGKVSAQFGIEGIPTTFLIDQNGKIVAKNVGMMTYEQL
    KRFAGK

    >gi|312793367|ref|YP_004026290.1| uba/thif-type nad/fad binding protein [Caldicellulosiruptor kristjanssonii 177R1B]
    MKLTDIQLERYSRHIILNEVGAKGQQKLLESKVLIIGTGGLGSPAAMFLAAAGVGTIGLVDFDAVELSNLQRQIIHFTPD
    VGKLKVFSAKEKINQINPDVEVVTYREMVNSSNIIDIIKDRDYDFIIDGTDNFPAKFLINDACVMLKKPFSHAGIIRFDG
    QTMTYVPEKGPCFRCIFQSPPPPDAVPT
    CKQAGVLGVMGGIIGTIQATEAIKYLLGIGELLTGYILIYNALKMDFRKVKI
    NKRESCEVCGENPTIKELIDYEQPQCDLKN

    >gi|312793736|ref|YP_004026659.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor kristjanssonii 177R1B]
    MKIVIIGGVAAGASAATKARRTNEHAQIVLLEQGEYVSFANCGLPYYVGGTIPKRDSLLVVREELFRKRYNIDVRTLSQV
    TKINRNRKTVTVLDKRNNTTYEESYDKLIIATGARPFVLPFLKDCKNSYTCFTLYDVDKIKEAFSAAPVKKAVVIGAGYI
    GMELAEQLNLLGVDCTIVELKSSILPQFDKEMTNPVVYTLKEKGIDVKTGVSVVDADVVDGVAKRLKLSNGEEVECNVVF
    QTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVIGSSIIKVFDWALAKVGLSEAECKDQGLDYNVTIVHPLHHAGYYPGGKQLTIKLIFDNSTGRIYGAQVIGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNIIRGEVKNILPDRVFELLDNPEYLILDVRTPEEYEF
    GHIKGAVNIPVDELRNRLNELPKDKKIIVY
    CGVGFRSYHGCLILKANGFDCWNMSGGWTSWRMYYPDMVE

    >gi|312793820|ref|YP_004026743.1| thioredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
    MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKNGKAVDKIIGARPKSDFVNFINRNL

    >gi|312794360|ref|YP_004027283.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B]
    MKLSVGYLLSPLGLIKIVGQDDSIVSVEFVSHKDEEEVISPVVKKAILQLKEYFEGKRTTFELKLRLDGTEFQKRVWSKL
    IDVPFGSVISYRELAEKVGKPQGARAVGNAVGKNPAVIIVP
    CHRVVKSDLDLGGFSGGIEKKIWLLSHEGWKIENGLLRK


    >gi|312794439|ref|YP_004027362.1| copper ion binding protein [Caldicellulosiruptor kristjanssonii 177R1B]
    MTKKIYIKGMTCDHCVRRVENSLKAIEGVSSVKVDLQGKVATIELSKDVKDEEFVRAIDDAGYEVARIE

    >gi|312794440|ref|YP_004027363.1| heavy metal translocating p-type atpase [Caldicellulosiruptor kristjanssonii 177R1B]
    MEKKTLSITGMTCASCARAIEKSVSKVEGVSNVSVNFALEKLIVEFDESKASIEKIKEAVERAGYGVLDDREETIREVSI
    PISGMT
    CASCARAIEKSVSKLNGIKEVSVNLASEKARVVYDSSVVRLSEIKNAIIKAGYTPLEIEKTSYEDSHQERKQKE
    INSLFRRFVIASIFAVPLLLIAMAHVVGAALPEIISPEKHPLNFALVQAILEIPIVIAGYKFYTVGFSRLFKFHPNMDSL
    IAVGTGAAILYGLFAIYQIAMGNYQYVKEMYFETAGVIIALVLLGKYLEAVSKGKASEAIKKLMGLAPKTAVVVQGDNEI
    VIPIEEVEVGDILLVKPGEKIPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIAQ
    IIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISALAWYFVDNSFIFALRIFITVLVIACPCALGLATPTAIMVGTG
    KGAEHGILIKSGDALETLHKITMVVFDKTGTITEGKPKVTDIIPANGWESERLLQIVASAERLSEHPLGEAIALAAKEKN
    LQLFEASQFEAISGHGIEAVVDGQKVLVGNKKLMKDKGIDIPMLLDVEKLTVEAKTPMFVAIDGKFAGIIAVSDVIKPNS
    RRAIELLHSMGIEVAMITGDNSKTAKAIAKQVGIDRVLAEVLPQDKANEVKKLQREGKKVAMVGDGINDAPALAQADVGI
    AIGSGTDVAAEAADVVLMKNDVLDVVNAILLSKKTIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAALAMAF
    SSVSVVSNALRLKRFTPVN

    >gi|312794623|ref|YP_004027546.1| peroxiredoxin [Caldicellulosiruptor kristjanssonii 177R1B]
    MENTNRIPLLGEKFPSMTVKTTHGVKKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKKAEEFKKLNSELIGLSVDQVF
    AHIKWIEWIEEKLGVKIPFPVIADELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKA
    LQTSDQNGVATPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKAGEIECFDWWFCYKKL