Acinetobacter sp ADP1

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50083307|ref|YP_044817.1| iron-sulfur cluster insertion protein ErpA [Acinetobacter sp. ADP1]
    MNAQALVITDNAAKKVRQLRDSEGNQDLMLRVYVTGGGCSGFSYGFNFADSPNEDDAEFVNGDVKMLVDSLSYQYLVGSV
    VDYIEGLEGSRFIIQNPNATTTCGCGSSFSI

    >gi|50083339|ref|YP_044849.1| thiol:disulfide interchange protein, periplasmic, alkali-inducible [Acinetobacter sp. ADP1]
    MKKFVLGGLSAAIMAFSGTTMAADFVAGKDYTVIANPGKVDVPGKIEVREFFWYGCPHCYKLEPFMQTWLKQLPKDVNFI
    RTPAAMNKVWEQGARAYYVSEALGVRQKTHLPLFHAIHAQNQQLFDQASLAKFYVNYGVPEQKFNSMFNSFPITSKIAES
    NKLAQQYQLTGVPAIVVNGKYVVQGEDGKVTQVVNYLIQKERTAKK

    >gi|50083443|ref|YP_044953.1| hypothetical protein ACIAD0158 [Acinetobacter sp. ADP1]
    MSIIARSTVKTDPAPWKGEVATGQHHLITDKPESFGGHDTGPAPYDFLTTSLASCTMITLRMYAQHKEIDFGEFHVEVDF
    FMNKEQQEWIERRVTFKHPLSAELQEKVLNVCSKTPVTKTLLRSVEIKTTIV

    >gi|50083475|ref|YP_044985.1| glutathione peroxidase [Acinetobacter sp. ADP1]
    MSQSIYHIPVQTISGQDTSLDTYRGKVLLIVNVASKCGLTPQYEGLEKLYQDKQQQGLEILGFPANNFLEQEPGSNDEIQ
    QFCSLTYDVHFPLFGKISVAGEDKHPLYQTLIEAQPERIGEGPWWKDLVDYGLTPNPKPEVLWNFEKFLINKNGEVVARF
    APDITADDPRLVDAINAELAK

    >gi|50083542|ref|YP_045052.1| thiol:disulfide interchange protein [Acinetobacter sp. ADP1]
    MTFTRSHLLIACALAGSFALSACSKQDQSANQDTLTANTPATGEASTLSERNAQQRLISTLQQHLKTANINAKIVNVQAT
    EVPNLYWVSLEGMPSIYATSDGKYIIQGDVIRLGDKQLVSVGDALQATENKKLFAALKKEDLIVYPAKDGKAKHVIYVFT
    DAS
    CPYCHKLHEHLDEITAKGIEVRYIAWPRGEQFMPTMEAVWCSQDRKAAFTQAVQGQPVQAAQCKNPVREQYQLGLNI
    GVNGTPAIYNTNGEYLGGYLTPDELVKRLK

    >gi|50083597|ref|YP_045107.1| putative dithiol-disulfide isomerase involved in polyketide biosynthesis [Acinetobacter sp. ADP1]
    MRVDIWSDVVCPFCYIGKKRLEHVAAEAGIELDVHWHSFELDPDAPTSHDTSNTERLAKKYGRTFEEMQEMQQNIASMAA
    QEGIDFQWQKANSGNSFNAHRIIHLAQSKGLGNEAEEAFFHAYMTEGLAIGEREVVEEIASRIGLDHAEVEFVLDSNELS
    DFVRHDEKIAHEQLNISGVPFFVFDQKLALSGAQPKEVFLQVLQKALTQRENDAVAEASSDAVCSDDSCDIPQKS

    >gi|50083608|ref|YP_045118.1| transcription regulator AraC [Acinetobacter sp. ADP1]
    MKNLSTTQFMTMAAVIDYLYQHQDKQPTLEQIAASVGLSSGYVQRQFQEWVGISPKKFVQYLSLQHAKSLLQQQSSILDT
    ALDSGLSGTGRLHDLFIQFEGMTPGAYKQRGVSVCLNYSYETTPFGEIFVASTPKGICSIQFIQTTSEYEQPLNELRQKF
    VAADFCHRSAPLHQQVSAWISGDLTQCLQQKLPLCLQGTPFQLKVWEALLCIPAGQLRSYQQIAEQIGQPQAVRAVASAV
    AKNPIAYLIP
    CHRVIRSTGAIGEYHWHRSRKLALLSCEMAKYGNQG

    >gi|50083688|ref|YP_045198.1| alkyl hydroperoxide reductase protein [Acinetobacter sp. ADP1]
    MSLINTEIKPFQATAYQNGQFIDISEADLKGKWSVVFFYPADFTFVCPTELEDLADQYAEFQKLGVDIYSVSTDTHFTHK
    AWHDTSDAIGKIQYAMIGDPTWTISKNFEVLIEAEGLADRGTFVIDPEGKIQIVEINAGGIGRDAQELLRKVKAAVYVYN
    HPGEVCPAKWKEGDATLAPSIDLVGKI

    >gi|50083748|ref|YP_045258.1| methionine sulfoxide reductase A [Acinetobacter sp. ADP1]
    MRTIMQQALFGGGCFWCTEAVFQQIRGVEKIVSGYAGGVNENPTYEAVCTGETNHAEVILIDFDESQVSYDDLLHVFFAI
    HDPTTLNRQGNDIGTQYRSVIYYFDEHQKQDAEKLIAELKAEGMSVVTELSPMPTFYPAEDYHQDFYTKNPSQGFCNFAI
    PPKIAKLRSKFQSLLKA

    >gi|50083862|ref|YP_045372.1| hypothetical protein ACIAD0629 [Acinetobacter sp. ADP1]
    MFFIYDFAMIMQFNSRYSDLNAKLYHQQAPVPLKGAKAGHFNEAIADELQWTSQEKQSWVDICSGQKTFDAFKPLAMVYA
    GHQFGQWAGQLGDGRGLLIGQVLHRSGQTIDLHLKGAGLTPYSRMGDGRAVLRSVIREYLAGHALNSLRVASSNAIGFTT
    SEQGVQRETLEQGAMLLRTSDCHIRLGHFEWINQYAPELLAEFTQKCIEWHYPEALQAEHPILAFAEGVIKNTAKMIADW
    QLVGFAHGVMNTDNLNITGSTLDFGPYGFMERFRPNWINNHSDHQGRYAYQNQPSIAHWNLWIWLNNLIPLSKPEDKETF
    KKQLADCLEHFEPTFLTAYTEGLCKKLGLPDFHKDSFDCGMAFLKVLQSEQLDYTQSFLRLQNHDYKALRDDCLDTRQFD
    DFLNLYHQIREHQDITALDQTMCDVNPVYILRNHMAQQAIEQAERGDFSEVERLFTLLAKPFTRQPALEKEQDLAPLPSD
    VPEIMVS
    CSS

    >gi|50083879|ref|YP_045389.1| putative antioxidant protein [Acinetobacter sp. ADP1]
    MRFCTMTLRLGDTAPNFEQDSSEGLINFYDFLGDSWGILFSHPADYTPVCTTELGYTAKLKDEFEKRHVKAIALSVDDVD
    SHQGWIKDINETQQTTVNFPILADKDRQVSELYGFIHPNASETTTVRSLVIIDPNKKVRLIITYPASTGRNFNEVLRVID
    SLQLTDNYKVATPANWQQGEDVVIVPSIKDEAELKERFPKGYKAVTPYLRLTPQPDQK

    >gi|50083918|ref|YP_045428.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-alkyltransferase) [Acinetobacter sp. ADP1]
    MWNIMEQLFYRYIDSPVGKLKLVASDTALVAILWENENPKRIQLANLTQAFQHPVLLQTKLQLEEYFLGKRQYFEISLDL
    QGTPFQRQVWTALQTIPYGKTCSYKQIAQMVGREKAMRAVGAANGKNPISIIVP
    CHRVIGAAGTLVGFAGGIDKKQKLLA
    LESSFTI

    >gi|50083935|ref|YP_045445.1| putative thiol:disulphide interchange protein (DsbC-like) [Acinetobacter sp. ADP1]
    MKTWLTTLILSLSTLGLAHADVATTQQNLKKNFPEIPVSAVNTTPVKGVYEVITEGQIVYTNDDAQYFFVGNLVDPKNQR
    NLTAERMQQLNKIDVSTLPLNQAIKHVKGNGKRTLYIFSDPD
    CPYCQRLEKELTAVDNVTIYLFLFPLTTLHPNAETIAT
    QIWCSKNQYQAWQDYLLNHKAPTASQKCSTPIQKNLALGQKLNINGTPTMYLKNGERIAGAMQAGQLNTLLDQAQ

    >gi|50083969|ref|YP_045479.1| oxidoreductase [Acinetobacter sp. ADP1]
    MSFQYDVIVLGAGASGLMLASHAAKRGRSVLILEKANKIGKKILMSGGGKCNFTNLYVEPEHYISHNPHFVISALSRYTN
    WDFIGLVCDYGIDYEERKHGQLFTLKGAKEILNMLLSECDKTGGVTIKTESEVKAVTKLDDSRFQVSTPHGMYYAESVVV
    ASGGLSIPTLGGSGFGYELAKQFGHRVYPTRAGLVPFTFSDQFKEVTTRLSGNALDATLSNHKNSFTEALLFTHRGLSGP
    SSLQLSNYWESGENFQIDFFPSHDLIDFFKKKKQQQPKVLLRTLLSELAAKSIVLELQQLIWSQHADTAIGQLSDAVLDE
    ICQQLHAFNVKPSGTEGYRTAEVTLGGVDTTQISSKTMQSKQVEGLFFVGEVMDVTGHLGGYNFQWAWASAFAAAQYV

    >gi|50084066|ref|YP_045576.1| bacterioferritin comigratory protein [Acinetobacter sp. ADP1]
    MDLLMMIRNVVLSCALVFTGTVFSSQIFANPFSNQNQAEKQWVGQPAPAFKLQDQNGKWHSLSDYAGKWIVLYFYPKDNS
    PG
    CTQEANQFKALYPQFLKSNAAVLGVSLDDVQSHQKFSEKLGLNFPILSDDNHQLAEKFGIVRNLGIVKIAKRESFLID
    PKGTIVYHYTSVNTQTHADEVLKDLKRFQSK

    >gi|50084100|ref|YP_045610.1| thioredoxin reductase 1 [Acinetobacter sp. ADP1]
    MSARHSRLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLTGPALMERMQAHAERFGTEIV
    YDHINEVDLKTRPFVLKGDMDEYTCDALIIATGATAQYLGLESEAAFMGQGVSA
    CATCDGFFYKNQKVMVVGGGNTAVEE
    ALYLSNIASHVTLVHRRDSLRSEKILQDHLFAKEKEGKISIVWNHQVDEVLGDTTGVTSVRLKSTQDESTQTIDVQGLFV
    AIGHKPNTEMFKDQLELRDGYIQVQSGTKGNATATSVAGVFAAGDVADNIYRQAITSAGSGCMAALDADFYLDSI

    >gi|50084195|ref|YP_045705.1| putative ferredoxin reductase subunit of phenylpropionate dioxygenase [Acinetobacter sp. ADP1]
    MERIVVVGAGQAAGWAVSTLRQEGFQGEIHVVSNEHQIFYERPPLSKQVLSKEASYDSLNLFSPEQIDAFSVQWHKPDLA
    TQIDRDHKQVILESGKILPYDKLLIATGSRARVPVNTWKDISNVVTLRDVQD
    CERLANLLETAKSIAIIGGGWIGLEIAA
    TARKQGKQVHVFEYAERLCGRSVSPEVSEFLKEIHEQQGTKIHLNSKNLHLIESSDQTVQVLNHPETAQTFDCVVVGAGA
    EIAKELGVSAGLAVKDGIVVNCYGQTSDVDIYAAGDVAIHPVLGYCIQSWANAQNQAIAAAKSMLGVATEYSDIPWLWSD
    QYQFNIQILGTYQAQSNPKLIIRQSSPAQLSYLYLDEHNRLMNLIAVNDAKLVKLAKRWIQNSTVLDPKLLADPEFNVMK
    LKP

    >gi|50084222|ref|YP_045732.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Acinetobacter sp. ADP1]
    MSMSDTQFDLVVIGAGPGGYVAAIRAAQLGLKTAIVEATHLGGICLNWGCIPTKALLAGAELAHQFKHASQFGFELGDIN
    FDLSKLVQHSRQVSAQLVQGIEHLLRKNQVSVFYAKARFIAKERLELVDAQQQKQMIRAPHIIVATGAHAASLPQIPVDG
    DYVWSYKEALQPKQLPKSLLVIGSGAIGSEFASLYQDLGSQVTLLDLARQILPTEDHEVAQYVRKQFEQKGMRILTESTV
    QHLEVCEGKVHCEIHDPSGVQSLSFDHVLSAVGVKPNTQNLGLEQLGVALTNGFIQTDEWCRTNVVGIYAIGDVAGAPCL
    AHKASHEAILCVEKIAGIADVHPLNRLQIPGCIFTHPQVASIGLTEQQAKAEGKQIHIGKFPMSANGKAIALGQTAGFVK
    TIVDVESGELLGAHMVGHEVTEQIQGYAIAQALEATDEHLAQVIFPHPTLSEAMHESILASMQRAIHI

    >gi|50084265|ref|YP_045775.1| rubredoxin-NAD(+) reductase [Acinetobacter sp. ADP1]
    MHPIVIIGSGMAGYTLAREFRKLNPEHELVMICADDAVNYAKPTLSNALSGNKAPEQIPLGDAEKMSTQLKLQILSETWV
    KAINPETHELKLEKNGQETIQPYSKLVLAVGANPTRLAIAGDGSDDIHVVNSLIDYRAFRENLAKRQDKRVVILGAGLIG
    CEFANDLQHTGHQVTVIDLSPRPLGRLLPAHIADAFQKNLEESGIHFVLSTTVEKVSKINDGQDYAVTLANGQTLVADIV
    LSAIGLQPNIDLAKHAGVHTSRGILTNSLLETNLEDIYAIGDCAEVNGTLLPYVMPIMQQARALAKTLSGETTHVHYPAM
    PVAVKTPAAPLTVLPVPVDVDVNWETEEFEDGMLAKAIDNTDTLRGFVLLGATAGKQRLTLTKLVPDLIPAQL

    >gi|50084419|ref|YP_045929.1| putative glutaredoxin-like protein [Acinetobacter sp. ADP1]
    MRLVEDLSMTEQARDTEALIRDQIAKHAVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPAIANW
    PTFPQLWVNGELIGGSDIMLEMFQNGELKPLVEQYSAAPDA

    >gi|50084421|ref|YP_045931.1| alkyl hydroperoxide reductase subunit F [Acinetobacter sp. ADP1]
    MLDQNIKTQLKAYLERLESPIELVAALDDSDKAAKIKELVTEIAELSNQVTARFDGQNTRRPSFGIAKAGEQPRVFFAGL
    PMGHEFTSLILALLQTSGYAPKVSDEILNQIKGLNLKADFDVFVSLS
    CHNCPDVVQALNLIAIYNPNSTATMIDGAFFQD
    EVEERKIMAVPMVFQNGNHIGQGRMTLEEIVAKLDSNAAEKDAAAINAKDVFDVLVVGAGPAGGTAAIYAARKGIRTGMI
    AERFGGQVMDTMDIENFTSVQKTVGPKFAADMEAHVREYDVDIMNLQRVSKIVGADQTASGLVEVELENGAKVESKTVIL
    STGARWRKMGVPGEQEYATRGVAY
    CPHCDGPLFKGKKVAVIGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKL
    NSLPNATIITNALSTEVIGDGAQVTGLKYKDRATDTEHTIELAGIFVQIGLLPNTDFLKGSVELSPRGEIIINERNETNV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRHG

    >gi|50084449|ref|YP_045959.1| hypothetical protein ACIAD1263 [Acinetobacter sp. ADP1]
    MQTSIHWIENVAFEAKSESGHSITMDGSAAYGGENRGPRPMELILMGLGGCASFDIVTILKKARQDVTDVVCQLQAERAD
    TIPAVFTKIHLHFVVTGKQIKEKQVAKAIELSAEKYCSASKMLTDGGVVITHDFEIIEVDA

    >gi|50084488|ref|YP_045998.1| putative glutathionine S-transferase [Acinetobacter sp. ADP1]
    MKLYYSPGACSLAAHIILNEINVDFDLEKVDLKTHKTEKGADYYEVNPKGYVPALEINPGLILTENVAILPFLAQHDPKQ
    DLIPPSGMGRAKVLEWLGYLNSELHDAYAVFFGAPLEGEAKEKAYKEVDRLLNYINRAIGESENEYLVDDNFGPADAYLF
    VLTNWSKSIGHDLSPYQNINAIRDKVAARQSVQIAMRDEGLIA

    >gi|50084579|ref|YP_046089.1| iron-binding protein, putative regulator believed to be involved in Fe-S protein formation or repair [Acinetobacter sp. ADP1]
    MIHLTETAANHVRNYLLNRGKGEGIRVGVKTSGCSGLAYVLEFVDDINEYDQVFEQHGVKVFVDPKSIVYLDGLEMDYVK
    NGLNEGFEFNNPNKKGECGCGESFTV

    >gi|50084747|ref|YP_046257.1| putative rhodanese-like sulfurtransferase [Acinetobacter sp. ADP1]
    MNAKINTSDHLKSAEKISSEHIFQQAQQYAEDHDLNFTGSVSPVDAWHLIQQGQAVLVDVRTNEERKFVGYVPESIHIAW
    ATGTAFNRNPRFLKELENKVGKDKTILLL
    CRSGKRSALAAEAAFNAGFEQIYNILEGFEGDLNQQQQRNSQNGWRIHQLP
    WQQD

    >gi|50084833|ref|YP_046343.1| hypothetical protein ACIAD1676 [Acinetobacter sp. ADP1]
    MHDFLLAFLGGLLLGTAVVGYLYINGRIAGISGLMAQILDPKTVFKTPAIWFLSGLFITPFIYSMFIETEIKITANPYML
    IIAGLLVGIGTRMGSG
    CTSGHGICGMSRLSKRSIVATITFMIAGFITVYVMRHLLGVLL

    >gi|50085206|ref|YP_046716.1| glutathione peroxidase [Acinetobacter sp. ADP1]
    MTNLYQFEAELLEGDTKSLADYQGKVLLIVNTASKCGFTPQFAGLEKIYEKYKDRGFEVLGFPCNQFGGQDPGSNNEIGA
    FCQRNYGVSFPMFAKVDVKGPEAHAIFRYLTREAKGILGSENIKWNFTKFLVGRDGKVLNRYAPTTKPESLEEDIEKALA


    >gi|50085207|ref|YP_046717.1| peptide methionine sulfoxide reductase [Acinetobacter sp. ADP1]
    MGKLNKTEREWQRELSPEEYRITRQKGTEPAFTGQYWNTKQSGTYVCRCCGTELFSSISKYDSGCGWPSFYKPINTTAIE
    EHDDFSHGMVRTEIVCHHCDAHLGHVFEDGPQPTGLRY
    CVNSASLQLKTDEKNDEETYP

    >gi|50085223|ref|YP_046733.1| alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like (detoxification of hydroperoxides) [Acinetobacter sp. ADP1]
    MSLINTEVKPFKATAYHNGQFVEVTEADLKGKWSVVFFYPADFTFVCPTELEDLADNYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSEAIKKIQYPLVGDPTWTLSKNFEVLIEAAGLADRGTFVIDPEGKIQIVEINAGGIGRDAQELLRKVKAAQYVHS
    HPGEVCPAKWKEGEATLAPSIDLVGKI

    >gi|50085355|ref|YP_046865.1| alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein) [Acinetobacter sp. ADP1]
    MIPIKLKNLLLWSFNMLDQNIKTQLKAYLERLESPIELVAALDDSDKAAKIKELVTEIAELSNQVTARFDGQNTRRPSFG
    IAKAGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSDEILNQIKGLNLKADFDVFVSLS
    CHNCPDVVQALNLIAIYN
    PNSTATMIDGAFFQDEVEERKIMAVPMVFQNGNHIGQGRMTLEEIVAKLDSNAAEKDAAAINAKDAFDVLVVGAGPAGGT
    AAIYAARKGIRTGMIAERFGGQVMDTMDIENFTSVQKTVGPKFAADMEAHVREYDVDIMNLQRVSKIVGADQTASGLVEV
    ELENGAKVESKTVILSTGARWRKMGVPGEQEYATRGVAY
    CPHCDGPLFKGKKVAVIGGGNSGVEAAIDLAGIVEHVTLVE
    FDTKLRADQVLQDKLNSLPNATIITNALSTEVIGDGAQVTGLKYKDRATDTEHTIELAGIFVQIGLLPNTDFLKGSVELS
    PRGEIIINERNETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRHG

    >gi|50085375|ref|YP_046885.1| soluble pyridine nucleotide transhydrogenase [Acinetobacter sp. ADP1]
    MPRKKEVVSGNFVRYDAVILGSGPAGEGAAMKLAKSGKRVAIVDIREQLGGNCAHVGTIPSKALRQTVSSIIRYQRDPMF
    QKVGEWKKFTMKQVLSHAHRVIQQQVATHTRFYDRNNIDVFYGRAYIQDQNTVLVFTPEGIKESIIFEQLVIATGSRPYQ
    PQGLDFKHKRVFDSDKILDLDYPIHKIIIYGAGVIGCEYASIFIGLNHKVDLINTQHKLLSYLDDEIADALSYHLREQGV
    LIRHNEQIDHLETHDDYVVLHLQSGKKIKADAILWCNGRSGNTDGLGLENVGLKPNGRGQLAVNEKYQTEVENIYAAGDV
    VGWPSLASAAYDQGRCAGANMSGEENVKPVTDIPTGIYTIPEISCFGKTEQQLTEEKIPYEVGQSSFRHLARAQITGDTV
    GELKILFHRDTLEILGIHCFGNNASEIIHIGQAVMQSPNNSLKYFMETTFNYPTMAEAYRVAALNGLNRLF

    >gi|50085487|ref|YP_046997.1| copper transporting ATPase [Acinetobacter sp. ADP1]
    MTNPPVKNQTIILPIEGMSCNACATRIEKVLNRLPDVQAHVNFASEKAQIELKSTESTLDDVIHHIEKAGFKVPPQHLEL
    SIEGMS
    CAACAARIEKVLNKQNHVEAVVNFSNETAHVDYVTGLITPEQIIQKIEKAGFKAIQKQELNSKDLQQHKQQQWK
    QQQHMLIIAIIFTLPLMVEMMGMMFGMHELIPRWIQWLLATPVQFWCGWQFYRNAYLSLRGGSANMDVLVVLGTTSAYLF
    SSVVVLFGLDQHVYFEASAAIITLVLLGKLLEARAKAKTGAAIESLLNLQPQIAHREIEGEISDIAVNELHSGDIFIVRP
    GESIPVDGIILEGTSEIDEAMLTGESMPVIKHPQDQVFAATINYHGVLRVKATGVGNDTVLAKIIGMVEQAQGSKAAIQK
    LADQIASIFVPVVIIISLLTLLLTWWLSQSFTSSLISAVAVLVIACPCALGLATPTAIMVGTGRGAQSGILFRNAQALEH
    AQKISVMVMDKTGTLTEGKPAVAHSKIEAGISVSHFWSAIKTLERDSEHPIARALVQHTETMQTDQLELQDFKVLSGHGI
    QARINGDLALLGSPRFLSEHDITLDHTLVEELEHQGNTVIALSIAGQLQGYIGLQDQLRADASSTIYALQQRGIEIVILT
    GDSPRVAKVIAKQLNIEKFVAGVLPQNKAAEVAKLKQQGHWVAMVGDGINDAPALATADISFAIGAGSDIAIDSADIVLM
    QSQLTGLINAIDLSKATLSKVKQNLFFAFIYNSLGIPLAALGLLNPVVAGAAMALSSVSVLTNSLLLRRWKPLKFNSTQE
    IK

    >gi|50085488|ref|YP_046998.1| putative heavy metal transport/detoxification protein [Acinetobacter sp. ADP1]
    MSTIQFTVEGMSCGGCSSKVKNTLEAFDQISQVEVELATGEVKVHVEPDQNIDKEQIKAAIEDLGFDVVN

    >gi|50085497|ref|YP_047007.1| molybdopterin biosynthesis protein (moeB) or thiamin-thiazole moiety synthesis (thiF) [Acinetobacter sp. ADP1]
    MNDQDNLDLELNDAEMHLYSRQILLDGWDVDAQEKLKFANVLIVGAGGIGCTSAELLARAGVGKITLIDSDTIEISNLQR
    QIAFTPNDLGCFKAEVLAKRLTQLNPHIVVEYIVNKLVSENVDELIQHQDLILDGCDNFTTRYLVNASCKKNQIPLISAS
    AIGFQGQLFMIDSDSACYECLFPKDQFENEGMR
    CAESGVLATTPVVMASLQAHHALLYLGLDRSPLREKLLLWDGMSMKQ
    RILHFEKDTNCSTCQASLSVNSVKFDTLPQ

    >gi|50085676|ref|YP_047186.1| bacterioferritin comigratory protein [Acinetobacter sp. ADP1]
    MFFMEIAMSTEHIQLPDQIFPTTHGEINLSEISKEWLILYFYPKDSTPGCTTQAVGFSCLKDQFDALNAKIIGVSRDSVK
    AHQNFTEKQALSIDLISDKDEVLCQHFDVIKEKNMYGKKVMGIERSTFIFKDKQLVKSYRKVKAAGHAEQVLEDLKALQN


    >gi|50085914|ref|YP_047424.1| dihydrolipoamide dehydrogenase [Acinetobacter sp. ADP1]
    MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRVHKGKPSLGGTCLNVGCIPSKALLDSSHHYEDTIHHLGDHGITT
    GEVNIDIAKMLARKDKVVENLTGGVAQLLKGNGIEWLQGTGKLLAGKKVEFVPFEGETQVLEPKYVILASGSVPVNIPVA
    PVDQDLIVDSTGALEFAEVPKRLGVIGAGVIGLELGSVWRRLGSEVVVFEALDAFLPMADKALSKEFQKILTKQGLDIRI
    GAKVSGTEVNGREVTVKYNQAGEDKEQVFDKLIVCVGRKPYAEGLLAEDAGIKLTDRGFIEVNDHCATSLEGVYAIGDLV
    RGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAVANGHEVKTGQFPFAVNGRALAAGEAAG
    FVKFVADAKTDRLLGMHVIGPGASDIVHQGMIALEFVSSVEDLQLMTFGHPTYSEVVHEAALAVDGRAIHAIQRKRK

    >gi|50085944|ref|YP_047454.1| hypothetical protein ACIAD2917 [Acinetobacter sp. ADP1]
    MEFSMNATVEQLAPVEQQATTDWVVAALYQFKEVADAADLQQRLLDLVKTINLCGTLIVASEGINGTVAGDRHAIDTIRE
    FLLNEGFHAMEYKESHSAEKPFRKMKIKLKQEIVTLGVEVKPRDLVGHYLDPKEWNELISRDDVILVDTRNDYEYKAGTF
    KGAIDPKTETFREFPDYVKQNLEQHKDKKIAMF
    CTGGIRCEKSTSLLLQEGFNEVYHLKGGILKYLEETPAEESLWEGEC
    FVFDGRTAVTHGVEEGQNVKCHACGWPLTPEEVALPSYEHGVSCVYCIEKTTEKQKEGFRMRQSQIAAAKRKRL

    >gi|50086039|ref|YP_047549.1| organic hydroperoxide resistance protein [Acinetobacter sp. ADP1]
    MSLEQVVYTAHAKATGGRDGRATSSDNILDVQLTVPKEMGGMGGGTNPEQLFAAGYSACFLGAMKFVATRDKFNIPKDAY
    VEGDVGIGPIPNGFGIEVKLHVHLPGMDTDEAKKLVDAAHIV
    CPYSNATRNNIDVDFEIVTDA

    >gi|50086050|ref|YP_047560.1| thioredoxin [Acinetobacter sp. ADP1]
    MEQTMSANIVNTTDANFQADVLDAETPVLVDFWAGWCAPCKAIAPVLEDLSREYEGKVKIVKVDVTACEDTAVKYNIRNI
    PALLLFKDGKVVAQQVGAAPRSKLAAFIDENV

    >gi|50086124|ref|YP_047634.1| hypothetical protein ACIAD3120 [Acinetobacter sp. ADP1]
    MSLIRWLVERWLEFMGNHPFLFGTLAILIVLFFIFEGQRNGRKISPQSLGILIKAKNAQLIDLRDAKDFREGHISGSRNI
    PYSQITSHVDELKASERPLVFI
    CNLGQVAGSALQKIGHADSYRLDGGISNWKAQGLPLVKAKTKA

    >gi|50086125|ref|YP_047635.1| glutaredoxin [Acinetobacter sp. ADP1]
    MAANITIYSTTVCPYCIRAKQLLERKGVKYKEINLSNEAPEVRVELMQRTHHRTVPQIFINDQFIGGFDQLYALERDGKL
    DELLA

    >gi|50086139|ref|YP_047649.1| putative rhodanese-like sulfurtransferase [Acinetobacter sp. ADP1]
    MFTSKECAMIRKQEITTFEFPENAIIWDVRDASSYAEGHVKGAVNQPIADLGADSLTQVPTDQPIYILCGGGSKAPRAAE
    KLEELDGSREYVILMGGTRAAQAAGIPLDQNS

    >gi|50086143|ref|YP_047653.1| thioredoxin C-3 [Acinetobacter sp. ADP1]
    MIVVCPSCGAKNRVPENKLAEQPQCGQCHAKLLPLAPIELNEQNFSHFITYSDLPVLIDLWAEWCGPCKMMAPHFAHVAA
    QNPQVIFAKINTETSPRLSQAFHVRSIPTLVLMNKTTEIARISGALRSTELQQWLDQQLHS

    >gi|50086148|ref|YP_047658.1| dihydrolipoamide dehydrogenase [Acinetobacter sp. ADP1]
    MYDIIIIGAGTAGISAYKEAVKYTQNILIMNDGPWDTTCARVGCMPSKVLISSANRFHDLTHLEEVGLKAHIEREIDTSN
    VMSHVRQLRDEFTAATLKDVNHWPKQRKISGKAVFIHPDTVQINNQQYQARSFILAVGSTPSVPAELKQRLKDRLITSDD
    IFELPTLPESVAVIGSGVIAIELAQAMSRLGVKTTIFARSKRIGTLTSPALQELAQQILSAELDIKFEILPDDMSLDQNK
    VKVSYTENGKKRTQHFDYLLHATGRDSLLATLDLEQISSQFSDVKKLPIDPDTKQLANLPIFIAGDAHTTTPVQHEAAYE
    GKMLVHNCLNFPKIENVKTLTPLGIVFCSPEMAIAGKSYKQLKEHDIDFITGYVSYEKQGRAKVLGKNKGATEIYIDPKS
    RQLLGAEILVEQGEHLAHLLVWMISEQSTIDTILNHPFYHPTLEEGLRTALKHARRQIDQIV

    >gi|50086483|ref|YP_047993.1| putative arsenate reductase and related [Acinetobacter sp. ADP1]
    MLKIYGIKNCNSMKKAFDALNAKGLSYEFHDYKKQGIDAKTLQDWLEKIGAETILNKKGTTWRKLSPEQQAFALTSEANL
    IETIIAQPSLIKRPVLKTSEGYVVGFDEAAYQQLSS

    >gi|50086487|ref|YP_047997.1| thiol:disulfide interchange protein precursor [Acinetobacter sp. ADP1]
    MLKSVQVQKIVAWFFGTIVLMLSLLVLPTYAAESLLSPEQAFSFSVESTDSNQAVLSWKIQPNYYLYQHKFEVRQSDQSI
    RLNLPPATDQYDENFGHSKVYYSHVQLSIKTAPAQHYQVTWQGCAKDRICYPPQTISFQTDQEGLVSQQNTSFTGKKRLT
    DLASLSAQATSEQADTPDHRSVSMSSSAVAQDQVWSSKLEQHSLGYGILLFLGLGILLAFTPCSLPMLPILTSLIVREHR
    GLKAWAVALTFVVSMATVYAVLGLIASSAGLNFQRWLQQPATLIGFSLLFIVFALNLFGLFELKLPQKLINQLDQIQSVQ
    QGGTLIGAAVMGVISALLVGPCMTAPLAGTLLFIAQTQDQWRGALLLFCLGFGMGIPLLIATFLGTKILPKAGQWMHQIK
    VIFAFIMLALAIYFIRPLLSDGWIQIVSLILGIAFIVYALYRLIKYPDQLKWLYLLLLLVVTPLVAFDQYQHSQRWFVQD
    TQKTVQWHTARTAVEFKQLLERVPAQQPVIIDVYADW
    CVACQPIEHRVLKDHDVQQALKSYYLIKLDLSHYDVSHQHLLN
    EWEILGPPTYLFLDQHHQEIRNLRLTGAFSKNELLQQLAAFKNIQR

    >gi|50086502|ref|YP_048012.1| disulfide bond formation protein (disulfide oxidoreductase) [Acinetobacter sp. ADP1]
    MQWSYRFVSGLLVLASIVGMTFALYLEHFKGLEPCPLCIFQRVGLMAMGIVALIAFLHNPVSNAFKRVYAFLATLGILWS
    VGVAIRHVWLQTLPPDQVPS
    CGPGLNYLLDALPLKTVLQQVLQGSGECAAIHWTFLGQSLPVWSLAYFSLILLVCVWQLL
    RRYPVIVTKKK

    >gi|50086515|ref|YP_048025.1| thiosulfate sulfurtransferase [Acinetobacter sp. ADP1]
    MDIMAGSEINLGLLIEAEELVPYLDHELLRVVDLSRNSVYEQLHLPQAIAVRPAQLVRQDELAMGLLPDEKQLQALIEYL
    NISPQHHVVVYDDEGGAWAGRLIWNLHCLGFTRTSLINGGIHAWLAAGLPTTSEAVVHEPVSDLLKVDLSHVADYQIGYP
    ALLSLVQQQAIQLWDCRTLDEYTGLRLAARRGGHMPGALHFEWSTALNRENHLKLHSFERIQQRLTQLGFQFNQPVVIY
    C
    QSHHRSGLAYIVARLLGWSVRAYDGAWSEWGNRLDSPVITGEQPF

    >gi|50086611|ref|YP_048121.1| putative thiol:disulfide interchange protein [Acinetobacter sp. ADP1]
    MVYFSDVSRGTCRSFLIKNTTQQVMNSSTLGFFDQLCVVMQNMKKQLLMGILVGVASLAHANLEQVQQQLKAHYPNVKIE
    NLQKTPMSGIYSGTLDNQIVYLGEDAEHLFVGSMIRLKDQRNLTKDLVVQQNSFRWSDLPLQDAIKTVKGNGKRQIAVFS
    DPH
    CPYCKQLERELDRLNNVTIYTFLYPLKSESFIPAQQIWCSPNRSYAWKNLINQNIQPQASSECANPIQRNLALGQRL
    KIQGTPTLFFSQGLKVTGVQTSTQIEQILKDVP