Caldicellulosiruptor hydrothermalis 108 uid60157

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312126273|ref|YP_003991147.1| peroxiredoxin [Caldicellulosiruptor hydrothermalis 108]
    MENTSRIPLLGEKFPSMTVKTTHGMKKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKRAEEFKKLNAELIGLSVDQVF
    AHIKWIEWIEEKLGVKIPFPVIADELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKA
    LQTSDQNGVATPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKDGEIECFDWWFCYKKL

    >gi|312126473|ref|YP_003991347.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor hydrothermalis 108]
    MIVLKYTLYGYNNIGVKLRMIYDCAVIGAGPAGLSAAINLAQTNRSVVVFATKEEDSSIYRAPEVNNYLGFHGVTGKELL
    QAFYDHAKKMGIEVVHKKVINFYKSGDIFTINANNEFFEAYSVILAIGTPKKTLLENEGEFVGRGISY
    CAVCDGMLYKGR
    TIAVIGEAIDAEEEAEYLSELAKKLYYIPLYKKNEFHFKDNVEVILSRPKSVYGEDFVNALELEDRTLNVDGIFIIRKTM
    PADQLIYGLEFTEDGHIKVDSKMQTSIEGLFAAGDVVGRPYQVAKAVGEGQIAGLSASTYVKMVKEKQK

    >gi|312126492|ref|YP_003991366.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor hydrothermalis 108]
    MKYLIIGASAAGLSCARTLRRLDSNGEIVVISKDDMVYSRCMLHYFISDDRPLDKMRFVEEDFFDKNKVKWIRNTAVIEI
    RPFNKSVVTSDGAEHTYDKLLIATGATPVIPPIEGLAEGIEKRKDIFTLRDIGDAIKIKEAAKTSRQAVVIGGGLIGLDV
    AVSLNKQGVKVTVIEMKDHILPQQLDKTAAQRYERIFKDNGIDIITGQAVSNVIYGLSGKVKGVTLSDGSFVFADMIVVA
    VGVKPSFPRIDKCDLEIENGIIVDQYQRTSIQDIYAAGDACQSYELLTQRHILTPIWPSAVKQGQTAAYNMAGIGKPLID
    NFGFKNSMKFFGLSTISYGYVEPPDNSYNVAICSGPNYYYKVVYKENVLYGAIIQGDISGAGVVGKLIQNKCNLSNKLVR
    NDWNNVFRLTYGDFFKQNQDGTFEFAC

    >gi|312126715|ref|YP_003991589.1| heavy metal translocating p-type atpase [Caldicellulosiruptor hydrothermalis 108]
    MEKKTLSVTGMTCASCARAIEKSVSKVEGVSNASVNFATEKLIVEFDESKASIEKIKEAVERAGYGVLDDGEENIREVSI
    PISGMT
    CASCARAIEKSISKLNGIKELSVNLASEKARVVYDSSQVRLSEIKNAIVKAGYTPLEIEKTSYEDSHQERKQKE
    INSLFRRFVIASIFAVPLLLIAMAHVVGVPLPEIISPEKHPLNFALVQAILEIPIVIAGYKFYTVGFSRLFKFHPNMDSL
    IAVGTGAAILYALFAIYQIAMGNYQYVKEMYFETAGVIIALVLLGKYLEAVSKGKASEAIKKLMGLAPKTAVVVQGDNEI
    VIPIEEVEVGDILLVKPGEKIPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIAQ
    IIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISATAWYFVDNSFIFALRIFITVLVIACPCALGLATPTAIMVGTG
    KGAEHGILIKSGDALETLHKITMVVFDKTGTITEGKPKVTDIIPANGWERERLLQIVASAERLSEHPLGEAIVAAAKEKN
    LQLFEASQFEAISGHGIEAVVDGQTVLVGNIKLMKDKGIEIDFLLDVEKLSQQAKTPMFVVQNGKFAGIIAVSDVIKQNS
    RRAIELLHSMGIKVAMITGDNSKTAKAIAKQVGIDRVLAEVLPQDKANEVKKLQGEGKKVAMVGDGINDAPALAQADVGI
    AIGSGTDVAIESADVVLMKNDILDVVNAILLSKKTIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAALAMVF
    SSVSVVSNALRLKRFKPVN

    >gi|312126716|ref|YP_003991590.1| copper ion binding protein [Caldicellulosiruptor hydrothermalis 108]
    MTKKIYIKGMTCDHCVRRVENSLKAIEGVSSVKVDLQGKVATVELSKDVKDEEFVRAIDDAGYEVARIE

    >gi|312127110|ref|YP_003991984.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ mal allergen [Caldicellulosiruptor hydrothermalis 108]
    MLNNRIKSVIFILISAILIGLLVYQIMSRSKENAAAEGIVNFKLVSVDGKEYSLSDFRGKKVVLNFFATWCPPCRAEIPD
    FERFHRENKDVVLIGINIQEDKATVEEFLSSMGVTYPVLLDRDGKVSAQFGIEGIPTTFLIDENGRIIAKNVGMMTYEQL
    KKFAGK

    >gi|312127343|ref|YP_003992217.1| thioredoxin [Caldicellulosiruptor hydrothermalis 108]
    MANNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVMEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKNGKAVDKIIGARPKSDFVNFINRNL

    >gi|312127429|ref|YP_003992303.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor hydrothermalis 108]
    MKIVIIGGVAAGASAATKARRTNENAQIVLLEQGEYVSFANCGLPYYVGGTIPKRDSLLVVREELFRKRYNIDVRTLSQV
    IKINRSKKSVTVLDKRNNTTYEESYDKLIIATGARPFVLPFLKDCKNSYTCFTLYDVDKIKEAFSAAPVKKAVVIGAGYI
    GMELAEQLNLLGVDCTIVELKSSILPQFDKEMTNPVVYTLKEKGVDVKTGVSVVDADVIDGIAKRLKLSNGEEIECDVVF
    QTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVIGSSIIKVFDWALAKVGLSEAECKDQGLDYNVTIVHPLHHAGYYPGGKQLTIKLIFDNTTGRIYGAQVVGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNIIRGEVKNILPDRVFELLDSKGHLILDVRTPEEYEF
    GHIKGAINIPVDELRSRLNELPKDKKIIVY
    CGVGFRSYHGCLILKANGLDCLNMSGGWTSWRMYYPDMVE

    >gi|312127758|ref|YP_003992632.1| uba/thif-type nad/fad binding protein [Caldicellulosiruptor hydrothermalis 108]
    MKLTDTQLERYSRHIILNEVGAKGQQKLLESKVLIIGTGGLGSPAAMFLAAAGVGTIGLVDFDAVELSNLQRQIIHFTPD
    VGKPKVFSAKEKINQMNPDVEVVTYREMVNSRNIIDIIKDRDYDFIIDGTDNFPAKFLINDACVMLKKPFSHAGIIRFDG
    QTMTYVPEKGPCFRCIFQNPPPPDAVPT
    CRQAGVLGVMGGIIGTIQATEAIKYLLGIGDLLTGYILIYNALKMEFRKVKI
    NKRESCEVCGPNPTIKELIDYEQPQCDLKS

    >gi|312128171|ref|YP_003993045.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor hydrothermalis 108]
    MQMKYDLIIIGGGPAGYLAAERASKGGLKTLLIEERYLGGVCLNEGCIPTKTLLYSAKILDSAKQGFKYGVEIQNITLNH
    KKVLERKDKVIKTLVTGIKSKLRKSGAEILSGHGEILGRNSKGYIVAVGDKEFATDRLLIATGSSPFIPPIEGVKEGLER
    GFVLTNREILEIESVPASMVVIGGGIVGLEMASYFNSAGSKVTVIEMLDHIGGSMDREISNILLEAYKKKGVEFELSARV
    TKIDDRKVVYEKDGKIFEKEAEKVLLSVGRRPNITGFGLENIGVEVEKGCVKTDERMKTNVQEVYAAGDVNGKLMLAHTA
    YREAEVAVWNMLGRKVKVNYDSIPSVVYTNPEVAWVGESEESAKEKALEYEVVKLPMLYSGRFVAENEEFDGLYKILIDR
    KKRTILGCHMIGNYSSEIIYGVGVMIESQLRAEDIKDIVFPHPTVSEIIREVIFEL

    >gi|312128324|ref|YP_003993198.1| fad-dependent pyridine nucleotide-disulfide oxidoreductase [Caldicellulosiruptor hydrothermalis 108]
    MKYIVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLAYYISGVIDNRKSIVPRDSQYFKKFNVDVRTAHEVL
    KVDVQNKKVIVKDLNTGNTFENSFDKLIIATGAHPVIPQIDGIELEGIFVLRNVKDADRIKEFINTYFPKKALIVGGGYI
    GLEMAEALKVLGMDVCIVEKQENILPNLDSDMARLVESYLEQKGVRIKTSTSVLRFEGDKRVKRAILSDGSKVEADFVLL
    AVGVRPSTQFLEGSGIQLLPNGAIKVDEYMRTNIEGIFAAGDCAAVYFKLNGKTMYVPLGSTANKMGRIAGENATGGSMK
    FSGILATSIFKVFDLTVAQTGYTEKMAQQDGIEYDVGHITKPHITTAYPGSEKMTIKALAELSSRKIIGAQIVGTKGVDK
    RIDVLATAIWAGLTTDDLFQLDLAYAPPFSSAKDPVHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFVVLDVRTPEQY
    KIKHIKGAVNIPLEMLQNKMNLLPKDKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGISNVTLEQLLERSTSNSSPS
    SP

    >gi|312128411|ref|YP_003993285.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor hydrothermalis 108]
    MKKSVGYLLSPIGLIKIVGQDDSIVSVEFVSRKDEGEVISPVVREAILQLEEYFEGKRTTFELKLQLQGTEFQKRVWNEL
    IKVHFGSVISYRELAKKVGKLQGARAVGNAVGKNPAVIIVP
    CHRVVKSDLSLGGFSGGLEKKIWLLSHEGWKIENGLLRK


    >gi|312128508|ref|YP_003993382.1| heavy metal translocating p-type atpase [Caldicellulosiruptor hydrothermalis 108]
    MAKVNVELILENLSCANCAQKIEEKVARLSFAEDVSLNFVTKKISAKVDQKHHETFVEAVKKIVNEIEPEVSVLEAPKEK
    PMLNMGEISAVVISAIFFGAGLLTRKEGFALIFFLFSYLLSGKNVILSFFKNLRKFQVFDENFLMTAATLSAIFLKEYPE
    AVSVMLLYKIGQIFEDVALNKSRKTIQALKHLEIEYANLKIGNEIRKVNPKDVVPGDIVVVKPGERVPVDGTVVSGKSFL
    DTSAITGESKFFAAQPNDKVLAGSVVVDGFLEIKAQSFYKDSSLHRIIEIVENASANKSKTEKFITRFAKVYTPAVVALA
    IIFAILPPLLFDQPFKLWIYRAAVFLIISCPCSLVISVPLSYFASISKLSLKGILVKGSQFIDILASKIGSFLFDKTGTI
    TNGVLSVEKIVPVEISQHEFLKILISIESLSNHPIAKSILKGIGKNSISFSSVQELKEHPGRGIEGIVDGKKVLIGTKEF
    LQESGVEINHSSEVSPELSYIFVSCDRKFCGYVALKDSLKDDVKKVLNDLKSFGAKIYLLTGDKKEAAEKIAKDLPIDGI
    YSELLPEEKVKVAEKIKLENKGLGYVVFVGDGTNDSPVLSVCDVGISFAGSASYLATTAADIVLLDERLSKIVDLIKDSR
    FTRKIVIQNIVLSLGIKFAVMFLGVLGVANLWEAVVADSGAMLLAVLNSLRVLKR

    >gi|312128525|ref|YP_003993399.1| methyltransferase type 11 [Caldicellulosiruptor hydrothermalis 108]
    MLNTKEYFNSLADKWDALVKHDIDKIEFLLGILRIKKGSCILDVGCGTGVLTEHLLKRVGSEGKVFGVDFSEKMIEIAKS
    KFKDFPNVELIVEDVNLLTFKNYFDYIICYSVFPHFEDKKEVLKQLHKMLKNGGILLIAHSQSRKAINQLHKSLPAPVNN
    HFLPSA
    CFIKMIAKGYFLNLKIIDNDEIFAIVLKKKNL

    >gi|312128711|ref|YP_003993585.1| redox-active disulfide protein 2 [Caldicellulosiruptor hydrothermalis 108]
    MVIKVLGGGCANCKKLMENAKRAAEELGIDAQFEEVKDIEKIMSYGVMRTPALVVDEKLIFSGRVAGVEEIKEVLKKEAG
    N