Caldicellulosiruptor bescii DSM 6725 uid59201

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222528078|ref|YP_002571960.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldicellulosiruptor bescii DSM 6725]
    MENTNRIPLLGEKFPSMTVKTTHGVKKLPDDYAGKWFVLFSHPGDFTPVCTTEFVAFAKKAEEFKKLNSELIGLSVDQVF
    AHIKWIEWIEEKLGVKIPFPVIADELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKA
    LQTSDQNGVALPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKDGEIECFDWWFCYKKL

    >gi|222528345|ref|YP_002572227.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor bescii DSM 6725]
    MSKVNVELILENLSCANCAQKIEEKVAKLSFAEDVSLNFVTKKLSAKVDQKHYSTFVEAVKRIVDEIEPGVRVLVAPKEK
    PMLNMGEISAVVISAIFFGVGLLTRKEDFALIFFLFSYLLSGKNVILSFFKNLRKFQVFDENFLMTVATLSAIFLKEYPE
    AVSVMLLYKIGQILEDVALNKSRKTIQALKHLEIEYANLKIGNSIRKVNPKDIVPYDIVVVKPGERVPVDGIVVSGKSFL
    DTSAITGESKLFSVQPNDKVLAGSVVVDGFLEVKAQSFYKDSALHRIVEIVENASVNKSKTEKFITRFAKVYTPSVVIIA
    IILAILPPLLFDQPFSLWIYRAAIFLIISCPCSLVISVPLSYFASISKLSSKGILVKGSQYIDILASKIGSFLFDKTGTI
    TNGTLSVEKIVPVEISQQEFLKILISIESLSNHPIAKSILSQVEQKDISLSSVQELKEHPGRGIEGIVEGKKVLIGTKEF
    LQENGVKIEYSFEKSPEFLYIYVSCEGKFCGYVALKDSLKDDVKKVFNRLKSLGSKIYILTGDKKEAAEKIVKDLPIDGI
    YSELLPEEKVRIAEKIKLENKELGYVVYVGDGTNDSPVLSVCDVGISFVKNSSYLATLAADIVLLDEKLYKIVDLIKDSR
    FTRKIVIQNIVLSLGIKFAVMFLGILGVANLWEAVVADTGAMLLAVLNSLRVLKR

    >gi|222528480|ref|YP_002572362.1| methylated-DNA/protein-cysteine methyltransferase [Caldicellulosiruptor bescii DSM 6725]
    MKKSVGYLISPIGLIKIVGQDDSILSVEFVTHKDEKELISPVVREAILQLEEYFESKRTTFDLKLQLQGTEFQKRVWNEL
    MKVPFGSVISYRELAKKVGKPQGSRAVGNAVGKNTAVIIVP
    CHRVVKSDLSLGGFSGGLEKKIWLLSHEGWKIENGLLRK


    >gi|222528550|ref|YP_002572432.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor bescii DSM 6725]
    MKMKYVVIGAVAGGMTAAMKIRRNDDKAEIIVYDKDTDISYSGCSLAYYISGVIDNRKNIVPRDSQYFKKFNVDVKTDHE
    VLKVDVQNKKVIVKDLKTGNIFEDGFDKLIIATGAHPVIPQIEGIELEGIFVLRNVKDADRIKEFINNNLPKKALIVGGG
    YIGLEMAEALKVLGMDVCIVEKQENILPNLDSDMARLVESYLEENGVAIRKGTSVLRFEGDKRVKRAILSDGSKIEADFV
    LLAVGVRPSTKFLEESGIQLLPNGAIKVDEYMRTNIEGIFAAGDCAAVYFKLNGKTMYVPLGSTANKMGRIAGENATGGS
    MKFSGVLATSIFKVFDLTVAQTGYTEKMAQEDGIEYEVGHITKPHITTAYPGAEKMTIKALAELSSRKVIGAQIVGTKGV
    DKRIDVLATAIFAGLTTDDLFQLDLAYAPPFSSAKDPIHYVGMVMSNFLDKRKFNCTQEKLLEKMQKGEDFIVLDVRTPE
    QYKAKHIKGAINIPLEMLYEKMNELSREKQIIVY
    CNSGVSSNIAQNILQQNGFRKVYNLSGGISNVTLEQLLEKNTSDSF
    SSSSSPQV

    >gi|222528709|ref|YP_002572591.1| dihydrolipoamide dehydrogenase [Caldicellulosiruptor bescii DSM 6725]
    MKYDLIIIGGGPAGYLAAERASKGGIKTLLIEERYLGGVCLNEGCIPTKTLLYSAKILEGAKHGFKYGVEVKNITLNHKK
    VLERKDKVIKTLMAGIKSKLRKSGAEILSGHGEILGRNSKGYIVAVGDKEFATDRLLIATGSSPFIPPIEGVKEGLERGF
    VLASREILEIESVPASMVVIGGGIVGLEMASYFNSAGSKVTVIEMLDHIGGSMDREISNILLEAYKKKGVEFELSARVTK
    IDDRKVVYEKDGKIFEKEAEKVLLSVGRRPNITGFGLENIGVEIEKGCIKTDERMKTNVQEVYAAGDVNGKLMLAHTAYR
    EAEVAVWNMLGRRVKVNYNSIPSVVYTNPEVAWVGESEESAKEKGLEYEVTKLPMLYSGRFVAENEEFDGLCKILIDRKK
    RTILGCHMIGNYSSEIIFGVGVMIEAQLRVEDIKDIVFPHPTVSEIIREVIFEL

    >gi|222529177|ref|YP_002573059.1| UBA/THIF-type NAD/FAD binding protein [Caldicellulosiruptor bescii DSM 6725]
    MKLTDTQLERYSRHIILNEVGAKGQQKLLESEVLIIGTGGLGSPAAMFLAAAGVGTIGLVDFDAVELSNLQRQIIHFTPD
    VGKPKVFSAKEKINQMNPDVEVVTYREMVNSSNIIDIIKDRDYDFIIDGTDNFPAKFLINDACVILKKPFSHAGIIRFDG
    QTMTYVPEKGPCFRCIFQNPPPPDAVPT
    CRQAGVLGVMGGIIGTIQATEAIKYLLGIGDLLTGYILIYNALKMEFRKVKI
    NKRESCEICGKNPTIKELIDYEQPQCDLKG

    >gi|222529289|ref|YP_002573171.1| NADH dehydrogenase [Caldicellulosiruptor bescii DSM 6725]
    MPLYRSHVLVCGGTGCTSGGSDKIYDAFIKEIEEQNLKDEVQVIRTGCFGLCAEGPIVIVYPEGAFYSKVADSDVKEIVE
    EHLLKGRIVKRLLYKESIEEGQIKSLNEVKFYKKQMRIALRNCGVINPENIEEYIAYDGYKALAKVLTEMTPEQVIDWVK
    RSGLRGRGGGGFPTGLKWEFAAKAPGDVKYVVCNADEGDPGAYMDRSILEGDPHSVIEAMAIAGYAIGSKQGYVYVRAEY
    PLAVKRLEIAIEQARQYGLLGKNILGTGFEFDIEIRLGAGAFVCGEETALMTSIEGHRGEPRPRPPFPAVKGLWGKPTLL
    NNVETYANIPVIILKGPEWFASIGTEKSKGTKVFALVGKVNNTGLIEVPMGTTVREIVEDIGGGIPGGKKFKAVQTGGPS
    GGCIPASLMDTPIDFDSLTALGTMMGSGGMIVMDEDTCMVDIAKFFLEFTVDESCGKCPPCRIGTRRMLEILQKITSGNG
    TEEDLEKLEELAYSIKDSAL
    CGLGQTAPNPVLSTLRYFRDEYEAHVKEKRCPAGACKALLRIVIDKDLCKGCGICAKNCP
    ANAITGQIKKPFEIDQSKCIKCGVCIEKCPFKAISKKA

    >gi|222529512|ref|YP_002573394.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldicellulosiruptor bescii DSM 6725]
    MKIVIIGGVAAGASAATKARRTNEHAQIVLFEQGEYVSFANCGLPYYVGGTIPKRDSLLVVREELFRKRYNIDVRTLSQV
    TKINRNRKTVTVLDKRNNTTYEERYDKLIIATGARPFVLPFLKDCKNSYT
    CFTLYDVDKIKETLSAAPVKKAIVIGAGYI
    GMELAEQLNLLGLDCTIVELKSSILPQFDKEITNPVVYTLKEKGIDVKTGVSVVDADVVDGIVKRLKLSNGEEIECDVVF
    QTAGVIPNVELAREAGLEVNRGIVVNNKMQTSDPDIYAAGDAVEVKSIITGKNVWIPLAGPANKQGRVAGCNAAGGNLEF
    KGVIGSSIIKVFDWALAKVGLGEAECKDQGIDYNVTIVHPLHHAGYYPGGKQLTIKLIFDNSTGRIYGAQVVGKEGVDKR
    ADVIATAIYAGLTVFDLENLDLVYAPPFSSAKDPVIMAGMTASNIIRGEVKNILPDRVFELLDNPEYLILDVRTPEEYEF
    GHIKRAINIPVDELRNRLSELPKDKKIIVY
    CGVGFRSYHGCLILKANGFDCLNMSGGWTSWRMYYPDMVE

    >gi|222529610|ref|YP_002573492.1| thioredoxin [Caldicellulosiruptor bescii DSM 6725]
    MADNIVTLTSENFEREVLQSDIPVVVDFWAAWCGPCRMVAPVIEELAQEYAGKVKFAKLNVDDYGDIAYAFRIMSIPTIM
    LFKNGRAVDKIIGARPKSDFVNFINRNL

    >gi|222529877|ref|YP_002573759.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldicellulosiruptor bescii DSM 6725]
    MLNNKIKNVIFILISAILIGLLVYQIMSRSKENAAAEGIVNFKLVSVDGKEYSLSDFRGKKVVLNFFATWCPPCRAEIPD
    FERFYRENEDVVLIGINIQEDKTTVEEFLSSMGVTYPVLLDRDGKISAQFGIEGIPTTFLIDEKGKVIAKNVGMMTYDQL
    KKFAGK

    >gi|222530241|ref|YP_002574123.1| copper ion binding protein [Caldicellulosiruptor bescii DSM 6725]
    MTKKIYIKGMTCDHCVRRVENSLKAIEGVSSVKVDLQGKVATVELNKDVKDEEFVRAIDDAGYEVARIE

    >gi|222530242|ref|YP_002574124.1| heavy metal translocating P-type ATPase [Caldicellulosiruptor bescii DSM 6725]
    MKKTLSITGMTCSSCARAIEKSVSKLEGVCSASVNFATEKLIVEFDENKASIEMIREAVERAGYGVLDDEETTIREVTIP
    ISGMT
    CASCARAIEKSISKLNGIKEVSVNLASEKAKVVYDSSKLRLSEIKNAIIKAGYTPLEIEKTYYGDLHQERKQKEI
    NSLFRRFVIASIFAVPLLLIAMAHLVGLPLPEIILPEKHPLNFSLVQAILAIPIVIAGYKFYTVGFSRLFKFHPNMDSLI
    AVGTGAAFLYGLFAIYQIAIGHYQYVKELYFETAGVIIALVLLGKYLETVSKGKASEAIKKLMGLAPKTAVVIQGDNEIV
    IPIEEVEVGDILLVKPGEKIPVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIAQI
    IKLVEDAQSSKAPIARLADVISGYFVPIVIFIAVISALAWYFAGSSFIFALRIFITVLVIACPCALGLATPTAIMVSTGK
    GAEHGILIKSGDALETLHKITMVVFDKTGTITEGKPKVTDIIPANGWEREMLLQIVASAERLSEHPLGEAIALAAKEKNL
    QLFEASQFEAISGHGIEAVVDGQTVLVGNEKLMKDKGIEIDFLLDVEKLSQQAKTPMFIALNGKFAGIIAVSDVIKPNAK
    RAIELLHSMGIEVAMITGDNSRTAKAIAKQVGIDRVLPEVLPQDKANEVKKLQGEGKKVAMVGDGINDAPALAQADVGIA
    IGSGTDVAIESADVVLMKSDILDVVNAILLSKKTIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAGLAMAFS
    SVSVVSNALRLKRFKPVS

    >gi|222530562|ref|YP_002574444.1| thioredoxin-disulfide reductase [Caldicellulosiruptor bescii DSM 6725]
    MIVLKYTLYGYNNIGVKLKMIYDCAVIGAGPAGLSAAINLAQTNRSVVVFSTKEEDSSIYRAPEVNNYLGFHGVTGKELL
    QAFYDHAKKMGVEVVHKKVINFYKSGDIFTINANNEFFEAYSVILAIGTPKKTLLENEGEFVGQGISY
    CAVCDGMLYRGR
    TIAVIGEAIEAEEEAEYLSELAKKLYYIPLYKKNEFHFKDNVEVILSRPKGVYGEDFVNALELENRILNVDGIFIIRKTM
    PADQLIYGLEFAEDGHIKVDSKMQTSIEGLFAAGDCTGRPYQVAKAVGEGQIAGLSASTYVKMVKGKQK

    >gi|222530597|ref|YP_002574479.1| redox-active disulfide protein 2 [Caldicellulosiruptor bescii DSM 6725]
    MVIKVLGGGCANCKKLMENAKKAAEELGIEAHFEEVKDIEKIMSYGVMRTPALVVDEKLIFSGRVAGVEEIKEILKKEAG
    K