Butyrivibrio proteoclasticus B316 uid51489

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302670029|ref|YP_003829989.1| methylated-DNA-protein-cysteine S-methyltransferase Ogt [Butyrivibrio proteoclasticus B316]
    MKTREEALSYGLSFPDTYQEAPFHDRNWQLIRVKKSRKAFLWTYEKDGFINLNLKVDPQWRDLWRKTYTAVLPAYHQNKE
    HWNTVVLDGSIPDDVIKRMIAESYDLVTDSPTKRIYEAVKKIPKGKVATYADVAEMAGDRKMARAVGNALHKNSDPSTIP
    CHRVVNSKGELAGEYAFGGAWKQGQILQSEGVEIVGNKVNLEKYRFRKNT

    >gi|302670889|ref|YP_003830849.1| heavy metal associated domain-containing protein [Butyrivibrio proteoclasticus B316]
    MKKTFKCEVDCANCAAKMEDAIKKIDGVVSARVNFMTQKLILEAADDVFDAVLDSAVKACKKVEPDCEIEI

    >gi|302671299|ref|YP_003831259.1| AhpC/TSA family protein [Butyrivibrio proteoclasticus B316]
    MLEVGTKAPDFELPDQNGEMHSLKDYRGRKVILYFYPKDNTSGCTKQACGFSERYPQFTEKGAVVLGVSKDTVASHKKFE
    KNYGLAFTLLADPERKVIEAYDVWKEKKNYGKTSMGVVRTTYLIDEEGVIIRANDKVKAADDAEKMLGELS

    >gi|302671303|ref|YP_003831263.1| AhpC/TSA family protein [Butyrivibrio proteoclasticus B316]
    MLEVGTKAPDFELPDQNGEMHSLKDYRGRKVILYFYPKDNTSGCTKQACGFSERYPQFTEKGAVVLGVSKDTVASHKKFE
    KNYGLAFTLLADPERKVIEAYDVWKEKKNYGKTSMGVVRTTYLIDEEGMIIRANDKVKAADDAEKMLGELS

    >gi|302671306|ref|YP_003831266.1| ArsC family protein [Butyrivibrio proteoclasticus B316]
    MNIQIFGTKKCNDTKKAERFFKERGIKYQFIDMKEKGMSKGELTSVASANGGIANLVNPDAKDKDAVALFQYIADEDKLE
    KLLESQQIIKTPVVRNGKQSTLGYQPDVWKKWE

    >gi|302671333|ref|YP_003831293.1| 2-enoate reductase [Butyrivibrio proteoclasticus B316]
    MNKEYEPLFTPWKIGNCQIKNRIVLTSMGGTNLLGWMEKNHFDKAGADFILEVARNNAGLVLPGCQPVYNPMFGQWLYTN
    KKMYQDLAVWMKEFHKTGAKLFVQLTAGFGRSFTISPMMEKLYTNKLLRVLSKPVMDLDKITASASESPNRWSDVVPSRA
    LTVEEIHEYVTAFGKTAKLLKEAGVDGVEVHAVHEGYLLDQFTLDYVNKRTDEYGGSFENKYRFACEIVQEIKKNCGKDF
    PVSLRYSVISKTRGFRQGALPGEDYDEVGRDFEESKRAAKYLQDAGYDMLNCDNGTYDAWYWAHPPIYMPENCNLEDVAA
    LRKYVDIPVVCAGRMDPKVAAEAVADGRIDGAGFARQFLADTEWLTKLMEDRQEDIRPCILCHNGCFNMCHYKGVPNDQD
    LSDSLHLARCAVNAETMQKDKHHIKKTGHPKKVIIIGGGIGGMEAARVLKLRGHEPVIYEKTDELGGTFIAASAESYKGK
    LRDLLKWYIRQMDVLGIEIHFNTEITSVKEFGKHDIIIATGAVPRILKSVPGHELMIEA
    CEYLRGREVGDKVAVIGGGLT
    GCEIAYELALQGKSPVIVEMKDDIISQKGVCLANSSYLREWFDLYRVPVYLETTLKEVWEDCIVCADKNGKEFTIDCDSV
    ISSAGYIPNPVVKENERESNMDYIGDCKQVGNLRSVIWRAYEVAMRI

    >gi|302671383|ref|YP_003831343.1| electron transport complex RnfA [Butyrivibrio proteoclasticus B316]
    METILSLVGLMISASLVNNVVLSQFLGLCPFLGVSKKTDTALGMGGACIFVITLASLVCSIIYKFILNPLDLSYLKTIVF
    ILVIAMLVQFVEMILKKYIVSLYQALGVYLPLITTN
    CAVLGVALNNVTDGYTILQSVVCGFATAVGFTIAIVILAGLREK
    MQYNDIPAPFKGMPLVLLTSGLMAIAFTGFSALK

    >gi|302671384|ref|YP_003831344.1| electron transport complex RnfE [Butyrivibrio proteoclasticus B316]
    MSTQAKKGALGFKQDTPAERFFNGLVVENPTLVLMIGMCPTLAVTSSAINGLGMGLATTFVLALSNAVISALRKTIPSTV
    RIPSFIVVIASFVTLVELLMKAYVPTLNKALGVYIPLIVVN
    CIIFGRAEAYASKHGIIPSFFDGIGMGIGFTCAITVIGL
    IREFIGAGTAFDVQILGEGTVVPGPVGDFLSGYQPISIFIQQAGAFFVLAFLIAIMNKIKSNMEKKGKDTSKFGEGCCSS
    AEEAAADKIMAEKAGKEAE

    >gi|302671817|ref|YP_003831777.1| PP-loop family protein [Butyrivibrio proteoclasticus B316]
    MSSCVIYNKDIKDMIADSRDKQIIDIREPEEFLKGSYPGAANYPWKEFDSYSDNLSKDSPIYLICHSGKKSMEICEELAY
    QGYEAYSIQGGIYSYYVYLMDNQYTDLAVLEEKRKSIEHSIIKKFRKELWSQFTKAINVYDLIKDGDKIAVCISDGKDSM
    LMAKLFQELEKHGKKNFKVVYMVMNPGYNRINYETILSNAKLMGIPVTVFDSDIFDVVDATSKGSPCYLCARMRRGYLYS
    KAKELGCNKIALGHHYDDVIETIFMGMTYGGQVQTMMPKLHSTNFEGMELIRPLYLVREEDIKRWRDYNNLTFINCACRL
    TESCASCGGTDKGSKRAEVKSIIAELKKTNPYIESNIFKSVENVSLNTIICYKTSDGQKHHFLEDYE

    >gi|302671846|ref|YP_003831806.1| thioredoxin-disulfide reductase TrxB [Butyrivibrio proteoclasticus B316]
    MYDLVIIGSGPAGLSAAVYAKRAGLNMIIIEKNPVSGGQIIDTYEVDNYLGIPGVNGFDLGMKFREHADKQGAEFVNATV
    TAVECVEKGSDTKAPVYKVITDNGEFETHTVILATGAHHSKLQIPGEEEFIGKGVSY
    CATCDGAFYRGKVTAVNGGGDVA
    VEDAIFLSRFCSKVYLIHRRDELRATKVLQEELFGLDNVEVIWDSVVKEIKGEDKVTHLVVENVKNEETNDVNVYGIFVA
    IAIVPSTDLFENMIECDEEGYVIANEDGATSAPGIFVAGDSRKKRLRQIVTAVADGANAVTSVQDFLVGKEK

    >gi|302671992|ref|YP_003831952.1| thioredoxin [Butyrivibrio proteoclasticus B316]
    MYILQLLFCFLRKAAVLSGKVNHMEYKFTQDNFEAEVMKSDVPVLIDFYADWCGPCKMMGPVVDEIAKEFDGKFKVGKVN
    VDESPDLAAKYNVMSIPFFAFIKNGELADSEIGAVPKDRLVQKLQGLA

    >gi|302672028|ref|YP_003831988.1| glutaredoxin-like protein [Butyrivibrio proteoclasticus B316]
    MLKVYGSEMCPDCIECKCNLDRNNIEYDNIDITNSLKGLKEFLKLRDKDATFDDAKDNGYIGIPALVTDDGKLTLDWESF
    FTQQGIEVVHPGEAGAACGIDGKGC

    >gi|302672032|ref|YP_003831992.1| rhodanese domain-containing protein [Butyrivibrio proteoclasticus B316]
    MKRRYLALGMLTLAIILTGCGAKTESDVTIIGGADGPTSVFLASKNDKVSYTQIDQETAKLMMDLNDGHVIVDVRRQDEY
    DEGHIPGAICIPNESITDSMPSELPDLEQIILVY
    CRSGRRSKEAAQKLFDMGYTNVYEFGGIIDWTGEIVTEEAKETAMK
    LSIDGKEMPVTWEDNTSVNELKEICPLKVNMSMYGGFEQVGSIGQSISRDDKQITTEFGDIVLYSGNQIVVFYGSNSWAY
    TKLGHIDLSEEELTQLLGNDDVVLEIE

    >gi|302672274|ref|YP_003832234.1| thioredoxin [Butyrivibrio proteoclasticus B316]
    MDYSLNSQNFEEEVLKSKVPVLVDFSADWCGPCKMMAPVIDELAGEYEGEMKIGKINVDQSPDIAQKYNVMSIPMFAFFK
    NGEVIETAVGALNKAKLQGIIDKVLA

    >gi|302672279|ref|YP_003832239.1| glutathione peroxidase [Butyrivibrio proteoclasticus B316]
    MGFYDYSVTDAQGNEVSMADFKGKVVLVVNTATGCGFTPHYKDIEAMYEQYHDQGLEVLDIPCNQFAGQTPGTDDEIHEF
    CQLHYNTKFPQMTKSEVNGEGQLPLYKFLKEQKGFEGFGKGPAALAMSVMLKKIDKDYKNNPDIKWNFTKFVVDREGNVV
    ARFEPTEDMKKVAECVASLI

    >gi|302669170|ref|YP_003832320.1| peptide methionine sulfoxide reductase MsrA [Butyrivibrio proteoclasticus B316]
    MKAYFAGGCFWCVTPIYKMYGVDKVVCGYSGGDEQNPSYEDVKAQKTGHRETIMLEYDPEKVSYDKLLDIFLANVDPFDA
    DGQFIDKGFSYTLAVYYTTEEEKLKAYTKISKLEADSGRKVQIALEKFKSFYEAEEYHQDYYLKNPEAFEKELIESGRKK
    G

    >gi|302669174|ref|YP_003832324.1| heavy metal translocating P-type ATPase [Butyrivibrio proteoclasticus B316]
    MEQYNVTGMSCAACQTRVEKAVSAVSGVESCAVSLLTNSMGVEGTALPQDIIAAVEATGYGASLKNNRESGAAATSEDSL
    EDKETPKMKKRLIASVVLLIPLLYVSMGHMLWEWPLPGFMDGNHVSMGLYQLILSGLIMVINQKFFISGFKGLLHRAPNM
    DTLVALGSAASYIYSVVALFAMTGAVLDNDTEQVMYYMNQFYFEAAAMILTLITVGKMLEARSKGKTTNALKGLMDLSPK
    TAVVVRNGVESTVPVEAVRVGDRFVVRPGDSIPVDGIVVEGESAVNESALTGESLPVEKITGDIVSAATINTSGYMVCEA
    TRVGEDTTLSAIIKMVSDAAATKAPIAKIADRVSGVFVPVVIGISVVTFFAWLLAGQSVGYAVARAVSVLVISCPCALGL
    ATPVAIMVGNGVAAKTGILFKTAASLEQAGKTQIVALDKTGTITTGEMKVTDVIASEESSEKELLRVAYALESKSEHPIS
    KAVTAYAAEKDIPLENTAEFEVLSGNGLQALLGSDRIYGGNLSYIEKIVELISSQNRSFIDKLAREGKTPVLIARNGKLL
    GIIAVSDVIKEDSPQAISELKNMGIHVVMLTGDNEITASAIAAQAGVDEVVASVKPDGKEAVIKQLMEHGVVTMVGDGIN
    DAPALTSADLGIAIGAGTDVAIDAADVVLMKSSIRDVAAAIRISRKTLRNIHENLFWAFFYNVLGIPLAAGCYVAAFGWT
    LNPIFGAAAMGLSSFCVVSNALRLNWIKPYDSKTDKAIKGAIIGNLIEKENTQIRKELGEMKITVKGMMCEHCEAHVKKA
    LEAIDGIESAVASHEQNLVTITNSKDVDETAIKAAVEEAGYEYVGILG