Burkholderia xenovorans LB400 uid57823

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91781428|ref|YP_556634.1| putative thioredoxin protein [Burkholderia xenovorans LB400]
    MPALNLDTDQDRIAERVNEAETLFVACLCAQWCGTCREYRDAFDKLADRHPEICFAWIDIETHADRFDDLDVENFPTILI
    EDSVTTRFFGTVLPHAAIVERMLSDLTALPGVSGAPKLRPALATA

    >gi|91781599|ref|YP_556805.1| putative thiol-disulfide interchange protein [Burkholderia xenovorans LB400]
    MKKLLSILFLSLGLVAATAHASPAAPVSGKDYTVLPTAQPTDVPAGKIEVTEFFWYGCPHCNEFNPYLEAWVKKQAPDVV
    FKRVPVAFRDDFIPHSRMYHALDALGLATQLTPKVFNEIHVNKDYLLTPEDQSKFLAKNGVDPKKYMDAYNSFSTQSALQ
    KDKKLLEDYKIDGVPTLAVQGKYETGPAATNSLPGTIQVLDYLVAQVRAKKM

    >gi|91781652|ref|YP_556858.1| putative thiol-disulfide isomerase and thioredoxins [Burkholderia xenovorans LB400]
    MSSTPSTAARRANPLRYIIIAAVAIAIAVAGYFAFAGQQRVPDATFTLLSGQKVSTADLKGKVYLVNFWATSCDTCMKEM
    PQMVQTYNRFKDQGLEFVAVAMNYDAPMYVTNYTQTRQLPFKVAMDDGSAARQFGNVQLTPTTFLVDKDGRILKRYVGEP
    QFAELDQLLEKALKPA

    >gi|91781663|ref|YP_556869.1| putative molybdopterin biosynthesis protein [Burkholderia xenovorans LB400]
    MNDDQLLRYSRHILVDEIGIEAQQRFIDAHAIIVGAGGLGSPAAMYLAAAGVGRLTLVDADTVDLTNLQRQILHVTASVG
    RKKVESGRDAIARINPEVVVNAVAERVDDAWLDAQVPHATVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQIST
    FDFRDEASPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIVGSMQAAEALKVIGGIGTPLLGRLMMLDSLRMEWNTMRIARQ
    PDCPVCGQTHAV

    >gi|91781666|ref|YP_556872.1| putative rhodanese-related sulfurtransferase [Burkholderia xenovorans LB400]
    MKFFTDYTNLVLIAIVLISGGLLLWPTISRRGRGGLSAAEATQLINRRNAAVIDLRPSADFAKGHLPAARHLEFAELQAK
    VAQLVKNKTNPVLLV
    CQTGQQSNKAARIVQDAGYAEVHVLEGGVDAWQKAGMPVVKQGVAK

    >gi|91781667|ref|YP_556873.1| putative glutaredoxin 3 [Burkholderia xenovorans LB400]
    MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEMMTRTGRRTVPQVFIGETHVGGYDDLSALDRAGGLM
    PLLEATA

    >gi|91781685|ref|YP_556891.1| electron transport protein SCO1/SenC [Burkholderia xenovorans LB400]
    MLKNRFARTARAAVIACALGGALLVAGCGKQPPAFQNLDITGNTQFASNFSLPDTSGHIRTMADYKGKVVVLFFGYTHCP
    DV
    CPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTPALLAQYVPAFNPTFVGLRPADQAQLTRITKDFRVYYAKVPG
    KTPDSYTMDHTAASYVFDTDGKLRLFARDGQGATPWVHDIKLLLD

    >gi|91781938|ref|YP_557144.1| 1-Cys peroxiredoxin [Burkholderia xenovorans LB400]
    MMSLRLGDIAPDFEQQSSVGPIRFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLASEFEKRNVKTIALSVDSAESHKE
    WIKDINETQAANVGFPILADGDRKVSELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQL
    TDSHSVATPGNWKQGDDVVIVPSLKDEEIIKQKFPKGYKALRPYLRMTPQPNK

    >gi|91782157|ref|YP_557363.1| hypothetical protein Bxe_A3678 [Burkholderia xenovorans LB400]
    MQNLTAPALAEWLADTSRPAPVLLDVREPWEIQTAAIAGAVSIPMREIPARSEELDDDVQIVCVCHHGARSAQVAMFLES
    RGHTNVFNLQGGIDAWSRQVDPSVPTY

    >gi|91782388|ref|YP_557594.1| thioredoxin reductase [Burkholderia xenovorans LB400]
    MPATSTKHAKVLILGSGPAGYTAAVYAARANLAPVLVTGLAQGGQLMTTTDVENWPADANGVQGPELMARFLEHAERFNT
    EIIFDHIHTAKLDEKPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYKQQHVAVIGGGNTA
    VEEALYLAGIAKKVTVIHRRDKFRAEPILIDRLLAKEKEGIVEIKWNHTLDEVTGDQSGVTGLRIKHTQTGETTDLALQG
    LFVAIGHKPNTDIFAGQLEMKNGYIITKGGLNGFATATSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYLETIDE
    MAGEHAMSQEAGR

    >gi|91782536|ref|YP_557742.1| hypothetical protein Bxe_A3293 [Burkholderia xenovorans LB400]
    MSIVNLSSYQFATIEDTAAWRPFVTERCNALGLKGTVLLAPEGINLFVAGTRENTDAFIHYIRHDALFEGKFADLQFKES
    LSDKQPFTRMLVKLKREIITMKKPAIRPELGRAPFVDAPTLKSWLDRGHDDEGRPVVMLDTRNAFEVDVGTFDNALDYRI
    TKFSEFPEVIEQNRADLEGKTIVSF
    CTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLEPSKTTQCFGCRAVVTPEAQQSPLYVAGKTCPECHPDSKAARAA

    >gi|91782680|ref|YP_557886.1| redox protein regulator of disulfide bond formation, OsmC-like [Burkholderia xenovorans LB400]
    MAESTVTAHIGSTNFQVLFDDGKHTWLADEPESLGGGDRGPTPVSLLLSSLGACTSITLKMYAQRKGWPLADVRVTLSLE
    TGEAGTTIDRRIVLEGDLSDEQRERLLQIANQ
    CPVHKILTHSITIRSGLAVA

    >gi|91782859|ref|YP_558065.1| copper-translocating P-type ATPase [Burkholderia xenovorans LB400]
    MSEPHGHVHGHAHARSPGPVPVDSAHASGPQRQGEPGAVYTCPMHPQIRASAPGNCPICGMTLELVTPLAVEERNVELES
    MTHRFWFALALSIPLLVMTMGPMVSSFDLGAAVNHIGARLARPHWMSASWAQYVQAVLATPVVVWAGWPFLQRGWTSFTT
    WQLNMFSLIGLGVAAAYGFSLFALFFPETLPQAFRRGHELPLYFEAASVIVTLILLGQVLELRARSRTSSAIRDLLELAP
    HTAIRVRSDGTEEAVPLEDVAVGDLLRVKPGSKVPVDGVVTDGSSSVDESMITGESIPSEKGAGSKVTGATVNQTGTFLM
    RAEKVGSDTLLARIVQMVAQAGRSRAPIQKLADKVSGWFVLTVLAVAVAAFVVWAAVGPAPALANALVVAISVLIIACPC
    ALGLATPVSIIVGVGRGAKEGVLIKDAEALELMEKVDTLVVDKTGTLTEGKPRVQTVVALAEQSESVVLSYAASLEGPSE
    HPLAQAIVAEAQKKNAQTKPVEAFNAIVGKGVSGRIDGHTAVLGNTALMEDTKVDCAAVRTEVDRLREAGQTIMYLAIDG
    TLAGYIGVADPVKETTAEAVRLLRASGIRIIMLTGDNPVTANAVAKTLSLDGVKAGVLPQDKYKHVQELQQQGHIVAMAG
    DGVNDAPALAQANVGIAMGTGTDVAMNSARVVLVKGDLRGIARARALSVATMKNIRQNLFFAFAYNVIGIPVAAGVLYPW
    LGVLLSPVLASAAMALSSVSVIGNALRLRAVRT

    >gi|91782892|ref|YP_558098.1| thiosulfate sulfurtransferase [Burkholderia xenovorans LB400]
    MSFVQAFRTRSFEDVRYALLEHEEIALVDVREEDLHARSHPLFAVNLPLSRLELDVPVRLPRQAVPIVVFDAGEGFAERA
    ARRLSELGYTDVALLEGGLQGWREAGGELFQDVNVPGKAFGELVESERHTPSLAASQVQALLDHEADVVVLDARRFDEYQ
    TMNIPGSVSVPGAELVLRARQLAPDPATRIIVN
    CAGRTRSIIGAQSLINAGVPNPVAALRNGTIGWTLAGQALAHGSSRR
    FDAVVDDQLRLAAADSARAVADRARVGRTSRDEARRWAGEAVRTVYRFDVRTPEEYEAGHVPGFRSAPGGQLVQETDMFA
    PVHGARVILADNDGVRANMTASWLAQMNIDVYVVDGLTAADFGEKGAAPAARHAPTPPDVDEISPAGLLTLLQSPGTAVL
    DFTDSANYVKRHIPGAWFVIRGELEKALLKLPDAQRYVLTGGSNPLARFAAPEVAALTGKPVQVLGGGTAAWIEAGLPVE
    SGETRLASPRIDRYRRPYEGTDNARDAMTAYLEWEHGLVAQLGRDGTHGFRVI

    >gi|91782911|ref|YP_558117.1| putative peroxiredoxin, bacterioferritin comigratory protein [Burkholderia xenovorans LB400]
    MNAWRNRQMKKKFISAVLAGAVSVGFAMHSLTASATLKPGDAAPAFTAQASLGGKTYTYSLADELKKGPVVLYFYPAAFT
    KG
    CTIEAHEFAEAVDEYKKYGATVIGVSHDNIDTLTKFSVSECRSKFPVAADADSKVIGEYDAGMPMHASMANRVSYVIA
    PDGKIIYEYTSLSPEKHVENTLKAVKEWAATHKQP

    >gi|91782999|ref|YP_558205.1| dihydrolipoamide dehydrogenase [Burkholderia xenovorans LB400]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENASHHLADHGIS
    VENVKVDIAKMMARKEGIVEKMTKGIEFLFRKNKITWLKGHGKFTGKTDAGVQIEVSGEGETETVTAKNVIIATGSKARH
    LPNIPVDNRIVADNEGALSFESTPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPEFLGAADQALAKEAAKQFKKQGL
    DIHVGVKVGEVKTTDSGVTIAYTDKDGNAQTLEADRLIVSIGRVPNTDNLGLEAIGLKANERGFIDVDEHCATAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEIIDGQKPHIDYNCIPWVIYTEPEIAWVGKTEQQLKAEGREIKTGQFPFMANGRALGI
    NKADGFVKMIADAKTDELLGVHIISANASDLIAEAVVAMEFKAASEDIGRICHPHPSLSEVMREAALAVDKRALNM

    >gi|91783424|ref|YP_558630.1| putative bacterioferritin comigratory oxidoreductase [Burkholderia xenovorans LB400]
    MPIAVDQPIPDFTAPATGGEITLSKLRGKKVVLYFYPKDNTPGCTTEGLQFRDLYPKFRKAGAEIIGVSRDSLRSHDNFK
    AKLELPFPLISDPEETLCALFNVIKMKKMYGKEVRGIERSTFLIDAGGVLRQEWRGVKVPGHVDDILEAVQAL

    >gi|91783454|ref|YP_558660.1| thioredoxin [Burkholderia xenovorans LB400]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKINVDEHQSTPVKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|91783506|ref|YP_558712.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MEFLSSIKALVPDYAKDIRLNLDGTIARSSLEGNDAVGVALAAAFAAKSTLIVDAIRNAGVLSPEEANGALTAAALMGMN
    NVWYPYIEMTGSADLKSQPAQLRMNAYASHGGVDKRRFEMYALAASIIGKCHF
    CVKSHFDTLVAEGMSSTQLRDVGRIAA
    VINATAQCIAAEGK

    >gi|91783507|ref|YP_558713.1| putative alkyl hydroperoxide reductase subunit C [Burkholderia xenovorans LB400]
    MKTVGDKVEAFTVTAAKPGFNHHEENGVSAFEEITEQSFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKDFEERDAVLMG
    GSVDNEFVKLAWRREHKDLDKLNHYAFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|91783538|ref|YP_558744.1| methionine sulfoxide reductase B [Burkholderia xenovorans LB400]
    MNKPDDLNTDAPAVQKDDAEWRKQLSDVEYQVTRHAATERPFTGRYHDHWDRGIYDCVCCGTPLFESDTKFDAGCGWPSY
    FKPINGEVIAEKTDRSHGMLRIEVQCKNCGAHLGHVFEDGPAPTGLRY
    CINSAALQFEPK

    >gi|91783539|ref|YP_558745.1| hypothetical protein Bxe_A2276 [Burkholderia xenovorans LB400]
    MSFSPSIAGLSGPLSALSDALTTAPESAFASLGSVFLTRLPAAPLSAPYVVGFSAETAALLGLEPGIENDPAFAELFSGN
    ATREWPAEALPYASVYSGHQFGVWAGQLGDGRALGLGEVEHGGRRFELQLKGAGRTPYSRMGDGRAVLRSSIREYLCSEA
    MHHLGIPTTRALCVIGSDQPVRRETVETAAVVTRVAPSFVRFGHFEHFYSNDRTDALRALADHVIERFYPHCREADDPYL
    ALLNEAVISTADLMVEWQAVGFCHGVMNTDNMSILGLTIDYGPFGFMDGFDAGYICNHSDSQGRYAYRMQPQIAYWNLFC
    LAQGLLPLLGEKHEESVRGDKAIEDAQRVLGGFKDRFAPALERRMRAKLGLETERAGDDALANRLFEVMHANRADFTLTF
    RNLARVSKHDASGDAAVRDLFLDRAAFDAWVNDYRARLSEETREDAARAIAMNRVNPKFVLRNHLAETAIRRAKEKDFSE
    VERLAAVLRRPFDEQPEHEAYAGLPPDWASSLEVS
    CSS

    >gi|91783788|ref|YP_558994.1| putative thioredoxin reductase, trxB [Burkholderia xenovorans LB400]
    MSSAANLPSPSPSPPIRTDVLIVGAGPVGLFAAFEAGVIGLSCQIVDGLDKVGGQCIELYPDKPIYDIPAIPSCTARELV
    ERLLAQCRPFDPPIHLEQRVESVEQGGDGRWTVRTDRGLVFDVAAILLAAGNGAFVPQKLALAEAVPLESRHVHYSVPRL
    ADFAGKTVVVAGGGDSALDWALALRKVARRVTLVHRRSGFSAADSSVESMRRAVEAGEMDFVVGAIAGLDVEDDALKSIT
    LRHIEGETQLAAEHLVALYGLVADLGPIAQWGLSIHGGRVDVDTSNYESSRPGIFAVGDIAHYPNKQKLILSGFHEASLA
    LRKAYSYAYPEKKRVHVHSSYDAKLAEKVSAAG

    >gi|91784132|ref|YP_559338.1| hypothetical protein Bxe_A1669 [Burkholderia xenovorans LB400]
    MARGTKTVVYGIPNCDTVKKARVWLEEHGVEFEFHDFKKHGVTEPLVQDWLKDVKLDALLNRRGTTWRGLSDDMKAAADT
    QPGAIALMIHKPSVIKRPVLVVNGRVKSLGFSADEYAALFA

    >gi|91784136|ref|YP_559342.1| glutathione peroxidase [Burkholderia xenovorans LB400]
    MTSIYSFSARTLGGEEVSLEQYSGKVLLIVNTASECGFTPQYAGLQKLYETYAARGLAVLGFPCNQFGKQEPGDAAQIGS
    FCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGVLGLEAIKWNFTKFLIDREGNVVKRYAPLTKPEAITEDIEKLL

    >gi|91784246|ref|YP_559452.1| Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans LB400]
    MRNAMAITLTEKAAQHVQKYLNRRGKGVGLRVGVRTTGCSGLAYKLEYVDELAPEDEVFECNGVKIIVDPKSLAYIDGTE
    LDFAREGLNEGFKFNNPNVKDECGCGESFRV

    >gi|91784258|ref|YP_559464.1| dihydrolipoamide dehydrogenase [Burkholderia xenovorans LB400]
    MSLVEVKVPDIGDFKDVDVIEVNIKPGDVIENEQALMTLESDKASIEVPSDTAGTVREVRVKAGDKVSQGTVIALVETSG
    EAAPAKDAPKAPAKEAEKAPAQAEAKPQAAEAPAAAPAKAAAPAPQAGSYSGSADIECDMLVLGSGPGGYSAAFRSADLG
    MKTVLVERYSTLGGV
    CLNVGCIPSKALLHTALVIDEAEALGAHGITFAKPQIDLDKLRDFKSGVVRKLTGGLAGMAKMRK
    VEVVTGNGAFVDPYHMEVQTEGGKKVVKFKQAIIAAGSEAVKLPFIPEDPRVVDSTGALELRQIPQRMLVIGGGIIGLEM
    ATVYATLGAKIDVVEMLDGLMAGADRDLVKVWEKYNSKRFANVMLKTKTTAAEAKDDGIHVSFEGEKAPAEAQRYDLVLV
    AVGRTPNGKKIGADKAGVAVTDRGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPS
    VAYTDPEVAWAGKTEDQLKAAGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAV
    EMGADATDIGKTIHPHPTLGESIGMAAELYEGVCTDLPPQKKK

    >gi|91784304|ref|YP_559510.1| mercuric reductase [Burkholderia xenovorans LB400]
    MPQHFNAVVIGTGQGGSPLAVRLGQSGRKTAVIERAAFGGTCVNVGCTPTKSYVASARAAHVARHCAELGVQVSGAISVD
    LAAVKARKDRIIGQSRDGVEKWLRGAQNVSVFNGHARFTGAHTLAISGPDGTVLEEISADEIFINTGTRAVVPPLEGIGR
    IRYYTNSNLLELTELPDHLVIVGGSYIALEFAQIFRRFGSRVTVLVRGERVLTREDADFAESVRKVLAREGVEFRFGVQP
    SRVEPHPHHPDEVCIGFEQNIPALEASHLLFATGREPNTDDLGLAAAGITTDRHGTIPVDGQLRTNVPGVWAIGDVNGRG
    AFTHTSYDDFQIVAANLLDGGARSVDTRIMAYAVFVDPPLARVGASEAEVRKAGRPALIATMPMSRVGRARERGETDGFM
    KVMVDRESRQILGAAIHGIEGDEAIHTFIDIMAAGAPYPTLQYAMHIHPTISELVPTLLDGLKPMQ

    >gi|91784710|ref|YP_559916.1| hypothetical protein Bxe_A1082 [Burkholderia xenovorans LB400]
    MTKAAPLTLYGRAWCHLCDDMRTALAPLLAEFGATVEVVDVDTDPTLEARYNERVPVLVCDGVELCHYHVDAARVRAALV
    ARLAAAS

    >gi|91784841|ref|YP_560047.1| disulfide bond formation protein B [Burkholderia xenovorans LB400]
    MNNDTAMLRRERSLLVLLALICLALVGGALYLQYFLHEDPCPLCIIQRYFFLLIAIFAFLGARFNSWRGVRLLEVLAALS
    ALGGIVTAARHVYVQANPGFS
    CGFDALQPLVDSLPPAHWLPGVFKVAGLCETAYPPILGLTLPQWSLVAFVIAFIPLALS
    LVRNRRRIA

    >gi|91785031|ref|YP_560237.1| methylated-DNA-(protein)-cysteine S- methyltransferase [Burkholderia xenovorans LB400]
    MFNAVIDAPFGKVGIRLEGEAVREIVYLPDSMQNVAPGTPLARQAAEQIERYFERASAKFELPLASVGTAFQKRVWQAIS
    DIPPGVVLTYGQLARQLGSAPRAIGQACGANYFPIVIP
    CHRVVSSSGIGGFANHAEEGFFRNVKRWLLAHEGIPYA

    >gi|91785037|ref|YP_560243.1| thioredoxin [Burkholderia xenovorans LB400]
    MDTTLATFEQDVITASTLAPVLVDFWAPWCGPCKTLGPMLEKLEAEAAGKWKLVKVNVDENQELAAHFQVRSIPHVMAFA
    DGRPVDQFVGVLPEGQLREFIERLVPQGADAARLEAQAALAEGRREDAYEALQAALAYDPGFDEARMDRIEMLLEDNRID
    EARGEVDLLSPKTTQGIDARFNAIKTRLDALDAAAALPPTDALEAKVAADPADLEARFDLASAFIARLKYAEALEQLLAI
    VQRDRTFRDDIGRKTMLSVFDLAAHQPELVSQWRRKLSASLF

    >gi|91785042|ref|YP_560248.1| peptide methionine sulfoxide reductase [Burkholderia xenovorans LB400]
    MNQTGEVATLGGGCFWCLEAVYLGVEGVNAVESGYAGGEARHPTYEDVCDGETGHAEVVKVDFDPAKISYREILDIFFAI
    HDPTQLNRQGNDVGTQYRSVIFTHSDAQREIALQAIREIGEQQIYDGQIVTQVLPLNDNYWPAEDYHQNYFAHHPNQGYC
    SFVVAPKVAKFRQKFAHRIKAS

    >gi|91785171|ref|YP_560377.1| iron-sulfur cluster insertion protein ErpA [Burkholderia xenovorans LB400]
    MNAVTDTPVTEMPAPFVFTDAAADKVKQLIEEEGNADLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVMNKSGVQLLIDS
    MSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV

    >gi|91785175|ref|YP_560381.1| putative OsmC-like protein [Burkholderia xenovorans LB400]
    MECKVSWMGQDGMAFAAETGSGHLVAMDGAPEGGGRNLAPRPMEMVLLGTGGCTAYDVVMILKKSRQEIAGCSVTLKAER
    ASEDPKVFTKIHFHFTVTGKNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFEIVAS

    >gi|91785245|ref|YP_560451.1| putative thioredoxin [Burkholderia xenovorans LB400]
    MRRILAGALIAIVAAGGGVLANHWLNGGAEVAHASQPASAESAVAQLWTEPVTTVDGKPQTLSLLKGHPIVVNFWASWCG
    P
    CVEEMPALSQLQRDYAKKGIQFVGLGVDSDKNVQAFLQKVKVAYPVYVTGFGGADLARAFGNTAGGLPFTVVIDAKGNI
    RSTKLGQIDPQALKQTLDAL

    >gi|91785249|ref|YP_560455.1| ribosomal protein L11 methyltransferase [Burkholderia xenovorans LB400]
    MSYRELIAELAREHAEEFSDALLELGALSVSVEDADADTPDEQPLFGEPGLTPDRTAWQRSRVIALLAPEHEPAVLLTAA
    ANEIGLEAAPSFTVREVEEQDWVRLTQSQFDPIKIGERIWVVPSWHDAPDPEALVLELDPGLAFGTGSHPTTRLCMEWLE
    QSVQPGQSVLDYGCGSGILAILAKKCGADPVYGIDIDPQAVESARHNSERNRAEVTYGLPDACPTGEFDIVVANILSNPL
    KLMASMLSSKVKPGGRIALSGILARQADEVAQVYARWIDISVWREHEGWV
    CLSGTRRESH

    >gi|91785251|ref|YP_560457.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Burkholderia xenovorans LB400]
    MSQVTLGGNPIEVAGTFPSVGQAAPAFSLVGKDLKPVSLADFAGKRKVLNIVPSLDTPTCATSTRKFNEAAAKLTNTAVI
    VVSGDLPFAASRFCTTEGIENVVTASTFRGHEFAQAYGVDVTSGPLTGLTARAVVVIDENDKVVHAELVGEIKNEPNYDA
    ALAALK

    >gi|91785287|ref|YP_560493.1| type 2 peroxiredoxin AhpC/TSAfamily [Burkholderia xenovorans LB400]
    MIQTGDKLPDATLFELIEDERAGCTIGPNSFDVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAGQLRALGIDEIWC
    VSVNDAFVMGAWGRDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVEAAGKFEVSDAG
    SILATLS

    >gi|91785326|ref|YP_560532.1| putative thiol-disulfide interchange protein, DsbC [Burkholderia xenovorans LB400]
    MKKTFRIAAAALAIAAVTIGCSAQADQTTDKLKATLQTRLADVTIKSVTKSPIAGLYEVNLGTQIVYSDANGDYLLLGDM
    VDAKTRKNLTEARLAETNRIDFASLPFGNAVKVVKGNGARKIAVFSDPN
    CPYCKQLETSLKSIDNVTIYTFLYPVLSPDS
    TMKSKSIWCSADRAKAWESWMQDHQAPTAAGTCDTAAIDKNLALGHAMNVDGTPTVFLADGRRLPGAVPADRLDKEMSAV
    R

    >gi|91785345|ref|YP_560551.1| glutaredoxin-like protein [Burkholderia xenovorans LB400]
    MDTQQRIKQIVDDNAVVLFMKGTAQFPMCGFSGRAIQILKACGVGEIKTVNVLEDDEVRQGIKQFSNWPTIPQLYVKGEF
    IGGSDIMMEMYESGELQQLFAAA

    >gi|91785362|ref|YP_560568.1| stringent starvation protein A, SspA [Burkholderia xenovorans LB400]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVGTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|91785436|ref|YP_560642.1| protein-disulfide reductase [Burkholderia xenovorans LB400]
    MFNGIDRRARRALRALFFLFGCLIFAQFGTSARAADDFLDPAVAFKFSATEKPGEVDVTYKIADGYYMYRERFAFATRNG
    TTTIGEPQLPAGHVKFDQTFNKNVETYRNELTIRIPVKQAAGPFDLAVTSQGCADAGICYPPMERVYHVSGAALQAAGSP
    EAAGAGVAQQSEQSAVAGSSWYERATSADYAQSLLQGGGFFAIVGLYFVAGAVLSLLPCSYPMIPILSAIIIGEGARVTR
    ARGFALSAAYVIGMALVYTALGIAAALIGQSLGAWLQNPWVLGAFGVLLTVFALTLIAGLDIALPQRWQDGVSRASAGRS
    GGKFAAVALMGALSALVVGACMTAPLFAVLAFIAHTGDAVLGGAALFSMGLGLGVPLLILGLGAGTLLPRAGAWMDGVKV
    FFGVVLLAAALWIVWPVLGATATMLLSALWLLIAAASLGLFSAPVAQASVWRRLGRGIGAALAVWAAVLLVGLAAGSSDP
    LRPLAVLAARGGEAGVAGVANASNKPDGASQSALTFVPVRSSTELDEAVKTAAQPAMLDFYADW
    CVSCKEMEKFTFSDPR
    VQAKLKQMNLLRADVTANNADDQTLLKRFSLFGPPGIIFFDQGGKEVLRVVGYESADKFLRSLDRARGTGA

    >gi|91785539|ref|YP_560745.1| periplasmic mercuric ion binding protein MerP [Burkholderia xenovorans LB400]
    MKKLVTVFAMALTASTAFAEGLRTVTLDVTNMDCAVCPITVRKAIEKVPGVATAKVDFATKRAEVIFDPKQTTVGALTKA
    TADAGYPSHLEREQ

    >gi|91785795|ref|YP_561001.1| AraC family transcriptional regulator [Burkholderia xenovorans LB400]
    MNRKPSETASGTASWTSDDERWEAVTRREPQADGAFFYGVKTTGVFCRPSCASRQPRRENVAFFTDAAAARAAGFRDCKR
    CQPGGLPRELEIVNRACAALDADRQQRLTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQCGSDVTR
    ATLDAGFGSPSRMYDSAPAELGMAPSAYRRKGAGLTVRYASASTPLGFVLVAATERGICKIGFGDDTATLADDLRSEFAN
    ADLLEDTVHLAPFIAQIDAYLRGTRQNFDLPLDIAATAFRQRVWEALRRIPYGETRSYSQIAEAVGTPRAVRAVASACAT
    NPVALAIP
    CHRVVAKGGALAGYRWGLPRKAALLDNEAQHAGVFSRGPITRDERVLADADAGVGNGNGNGNETTTTKLDHA
    A

    >gi|91777152|ref|YP_552360.1| putative DedA protein [Burkholderia xenovorans LB400]
    MLHDLVEQYGPALVFVNVLAASIGLPVPALPSLVLFGAMAAMHPGSVGTQLAPVLVLSIFATLIGDSAWYFAGRMYGGNT
    LKAICRLSLSRDTCVKKTERFFGRWGVRVLAVAKFVPGLSIVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIIGALFA
    KQIDMLFALAGRLGRTAALVAVALLLAYAAYRWIRRRQLIAKLASARIEVDELAALVKAGNTPVLFDIRSHEKRKLDPFV
    IPGTQFADERQLDEIVATYPRDQKLVIY
    CSCPNEISAAWMARQLNEAGFSDVLPLRGGMEAWRDSGKPVESLPDMPPPEV
    AVEDVAPKAV

    >gi|91777199|ref|YP_552407.1| copper-translocating P-type ATPase [Burkholderia xenovorans LB400]
    MPPRALPAMTELATAPRPANTADAADISAHTAELDIGGMTCASCAMRVEKALAKVPGVVSASVNLATETATVDLNGAAAG
    PDALIAAVRKAGYEAALVAPPDTPASANESAPADRKRDQTRRELAAVLASAVLTLPLIGPMVGEWFGFHAMLSPWLQFAL
    ASVVQFVFGARFYRAAFRAVRAGAGNMDLLVALGTSAAYGISVYELATHPGDMMHLYFEASAVVITLVRFGKWLEARAKR
    QTTDAIRALNALRPDRARIRVGAGERDVPLAQVRVGTIVIVRPGERVPVDGTVLEGRTHIDESLITGESLPVPKQVADAV
    TAGSINGEGAIAVTTTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEIFVPAILAIAALTLAGWLIAGAAGETAILN
    AVAVLVIACPCALGLATPAAIMAGTGVAARRGVLIKDAEALETAHRVTIVAFDKTGTLTLGQPSVTAFEPIGGISRDEAL
    ALAAAVQRNSDHPLARAVVKAYEAEAAATAAAAEAADMPAAIGEAVASPTRTRALHASAARAVAGRGVEADVDGRTLALG
    SGRWLGELGIELPPEFAARARELEAAGNTVSWLMQRAPLAPVALALIAFGDTVKPTARAAVERLAQMGITSVLVTGDNRG
    SAASVARALGIDEFHADVLPEDKARVIRDLKIRSAGIVAMAGDGINDAPALAAADIGIAMATGTDVAMHAAGITLMRGDP
    ALVADAIDISRRTWRKIRQNLFWAFVYNLIGIPLAAFGLLNPMLAGAAMAFSSVSVVTNALLLRTWRGAQNGSGR

    >gi|91777294|ref|YP_552502.1| organic hydroperoxide resistance protein [Burkholderia xenovorans LB400]
    MNILYKASATSTGGRDGRAVSSDNALDVKLAAPRELGGTGAAGTNPEQLFAAGYSACFLSAMKFVAGQHKQTLPADTQVT
    AEVGIGPNDKGGFALDIDLRVSLPGLDANAARELVDAAHQV
    CPYSNATRNNVAVRLQIA

    >gi|91777306|ref|YP_552514.1| 3-mercaptopyruvate sulfurtransferase [Burkholderia xenovorans LB400]
    MPHTHYTTLISAANLAERLAAAPGSVFVIDCRFDLADPEAGEKAYLAGHLPGAHYLHLDRDLSGPKNGQNGRHPLPDRAR
    LVETLESRGLKQGQQVVAYDAQGGMYAARAWWLLRWLGHDAVALLDGGLQAWEAGGYPLTQDAPAQNTGDFKAGAPLSVT
    VDAQTVERNLGSKERVVVDARAADRYRGENETLDRVGGHIPGALNRFFKDNLTADNRFKPAHTLREEFHALLAGTPPEHV
    ILQ
    CGSGVTACVNALAMEVAGLHGAALYAGSWSEWSSDPKRPVATGPNP

    >gi|91777323|ref|YP_552531.1| 1-Cys peroxiredoxin [Burkholderia xenovorans LB400]
    MDNIEEDFRAQRPPFLYEPAPDFEARSTMGMVSSADYRGKWLLFFSHPADFTPVCTSELIAFARIAPRFKELGCELLALS
    IDGLYSHLAWLRSIQERFNMDIPFPVVEDPSMAVAKAYGMLPPKAVSSSTVRGMFLIDPEGIIKAISWYPISTGRSVEEA
    FRLFQAVRMTWQENLYAPADWQPGSPCVVPPPKTIEDASKRLSEGDVLDWYYQTRQIAQDAPPERAPVKRGRRA

    >gi|91777335|ref|YP_552543.1| 1-Cys peroxiredoxin [Burkholderia xenovorans LB400]
    MSLRLGDIAPDFERQSSVGPIRFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLAGEFEKRNVKTIALSVDSAESHKEW
    IKDINETQAANVGFPILADGDRKVSELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DSHSVATPGNWKQGDDVVIVPSLKDEEIIKQKFPKGYKALRPYLRMTPQPNK

    >gi|91777470|ref|YP_552678.1| hypothetical protein Bxe_B2665 [Burkholderia xenovorans LB400]
    MTLQDRLDAFKADFKAGKPPYHAPPEIHPIMERATAELVASGQASRAIKAGDRAPLFTLKDQNGNDVSSAELLAQGPLVV
    TFYRGVW
    CPYCNIELHAINEALPQIRARGANVVAISPQTAVNSRKSVRDNSLNFPVLSDAKGETAAAFGLRFSLPDYLVD
    LYKNLRNDLPAFNDDPNWTLPMPARYIIGHDGIVLYSEVNPDYTHRPDPAEMFAVLDKANAKD

    >gi|91777580|ref|YP_552788.1| selenophosphate synthetase [Burkholderia xenovorans LB400]
    MTDTSVPTSTSPRLTSLSHGGGCGCKIAPGLLADLLKRSAPLPFFPDLLVGNDTADDAAVYKLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPLMALAIVGMPINVLPHDVIAAVLKGGESVCAEAGIPLAGGHSIDSVEPIYGLVAI
    GVVDPKRVKRNAGAQAGDVLILGKPLGVGILSAALKKDRLDAAGYAAMIAATTKLNRPGAELSRLDGVHALTDITGFGLL
    GHTLELARGSNLTARVRYADLPWLPDVVGLAEAGIFTGASGRNWDAYGKSIGLPASLPATARTLLTDPQTSGGLLVSCAP
    QAVDEVLALFRADGFGEACVIGEMVSGEGRVEVV

    >gi|91777728|ref|YP_552936.1| rhodanese-like domain-containing protein [Burkholderia xenovorans LB400]
    MDVRKMPKGIDAATLKRWLHDGSEIALFDVREHGQYGEGHPFYAVPLPYSVLERDVGRLAPNRRVRVVVYDSGDGDDGPA
    ARAAARLETLGYASVHVLEGGTRAWQDAGFVLFKGVNVPSKAFGELVEQVAHTPHISAQTLLQWQQSDTPPVVLDGRPLG
    EYRTMNIPGASCCPNGELAYRIDAFVPDAQTPIVIN
    CAGRTRSIIGAQTLLDLGIRNPVYALENGTQGWFLADLPLERGQ
    QRGYPADLRPQPARVAAARALAERAGVEWVHADTVRDWTKADDRTLYLCDVRTPEEFAANTLPGAQHAPGGQLQQATDQY
    IGVRNARIVLFDDDGIRAPVTASWLRQLGHEAWVLEGGLHSGLALADTRIPEPAALPLVDGDTLAQRLAAGSQSVVDLRT
    SAAWLAAHIPGSVWSIRPRLAATLAQCEQAVTFVVDDPRIAAWAVSDLAGGEGHTFSVLDGGFAAWPAGGWRVETDAVAD
    VLPPSARIDYLFFTHDRHAGNKAASREYLSWELGLLGQLDELERSAFRPLTRVVAAPE

    >gi|91777740|ref|YP_552948.1| putative DSBA oxidoreductase [Burkholderia xenovorans LB400]
    MQAIQVEVNYDFICPWCWIGQRNLAAALAETGAHAAVSIRYVPFELNPAMPAEGMDRRAYRSRKFGSWARSQIMDAQVTA
    AGLAAGVHFNYDKVLRTPSTRLAHRLMQFAQQRNDPQATAALYQAIYAAYFSEGRDIGSLDTLVAITAEHAFDADAVRAS
    LQGSAGNEAIEAARARAGSLGIQAVPTIRIDGDVISGAQPPAVFINALRAAAQRKAA

    >gi|91777933|ref|YP_553141.1| Ohr [Burkholderia xenovorans LB400]
    MTRIDNVLYRAHAKATGGRDGRAVVPESNLDLKLTTPKQLGGAGGEGANPEQLFAAGYSACFVGAMKFVAARDRIAIPAD
    VSVEGSVGIGAIPNGFGIEVELKISLPGMAQEAARALVDKAHIV
    CPYSNATRNNIAVTLTLV

    >gi|91778041|ref|YP_553249.1| hypothetical protein Bxe_B2088 [Burkholderia xenovorans LB400]
    MSFTPLADRAQDPDNALHPHTQKESRMSPVSAVPPADSAAALAHFSSLLSFETDCADVHAALESDDPHSVDFVLLDVRGP
    ALFARGHVRGAVNLLHGKIVASKLAGYPPDTLFVTY
    CAGPHCNGATRAAIKLAELGRPVKVMIGGITGWLDEGFQLATGS
    EKMICNPAR

    >gi|91778200|ref|YP_553408.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MFLNWSELLGTLKRSSNLLGNSNPKMLEAYRNLAAAQGSNGALDAKTRELIAIAVAVTTRCDGCISSHTAAAVQAGATEA
    EVADALGTAIALNAGAAYVYSLHAMEAMQSLK

    >gi|91778475|ref|YP_553683.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MSQLKAVEYSAASPEVKAVYDDIRQTRQVDDVNNFWKYIAQHPPTLARTWDSLKDVMAPGALDPLVKELLYVAVSVTNNC
    GY
    CVASHTAAARRAGMTDEMFGELLAVVGMANETNRLAVGYRVPIDPAFE

    >gi|91778550|ref|YP_553758.1| hypothetical protein Bxe_B1556 [Burkholderia xenovorans LB400]
    MTLELVERPTHALLEAARSRAAEAGLSYAGGVSPQDAWELVQAGDAVLVDVRTAEERKFVGFVPDSLHVAWATGTSLTRN
    PRFVRELEAKTGKDAVVLLL
    CRSGNRSALAAEAAAKAGFTQVFNVLEGFEGELDDAQRRGASNGWRFHGLPWIQD

    >gi|91778569|ref|YP_553777.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MSRLPLHTLESAPEASRPYLERAQAANGFLPNLVASLANAPTALETYLTVAEINGRSGLTLAERETVQITAAGIHGCGFC
    VAGHTAVALKKAQLDPQLVEAIREQQQPLPDPRLDAVAIFTRAVIATRGAVPDDALAAFRAAGFSDANALEVVLGVSLAT
    LCNFANNLAQNELNPQLAAYRWEAGAHAA

    >gi|91778645|ref|YP_553853.1| ankyrin repeat-containing protein [Burkholderia xenovorans LB400]
    MKGRHVFRRLTFDEVRAWLARRPDALLLDARDAASYARDGWPGAVRLSADNQDALLLRTDRQRPVLIYCYKGNASQVCAQ
    MFADFGFTDVCDLVGGHRAWTAGVDGSNPSSEALAPELAAWLAREGFIGTQARGAHGNTPLMNAAWRGAPAVVEQLLACG
    VALDAINEDGNNALWFACVNGNPSLVTRLVAAGVPMDHANANGATCLMLAASSGKAEVLSALLALGADPALRSEDGFTAA
    DMAASVDCLQLLRQLREA

    >gi|91778646|ref|YP_553854.1| nitrogenase-associated protein [Burkholderia xenovorans LB400]
    MAHLVFYEKPGCAGNGRQKALLRAAGHTLDVRDLLSWPWSADALLAFIAPLPVSEWFNRAAPRIKSGEIVPETLDADTAL
    ALLLAGPLLIRRPLMQCDARRMVGFDAAEVHAWVGLGAQPPAPGSPLEGCAATAAHGTDQHADQRTEQRTDQRTTRCTPS
    T

    >gi|91778659|ref|YP_553867.1| HesB/YadR/YfhF [Burkholderia xenovorans LB400]
    MLSNVTVTSAAEKFMRRIVRFSGLPAGAGFRLVVSAGGCSGYTAEFTVEPALQAGEQELDVNGLRIFLPAESRLMLEGVT
    IDFADTPTQSGLTFFNPNQAACGCSSSGESTPPGVATIEIGAIGRGRPPLPRQVS

    >gi|91778664|ref|YP_553872.1| iron-sulfur cluster insertion protein ErpA [Burkholderia xenovorans LB400]
    MQTLAQPAAATSGALPALLEFTRQAAAKVASLIEEEGNPNLKLRLYVSGGGCSGFQYGFAFDDQVADDDMQTVTDGVTLL
    VDSMSLQYLPGARVDYEDGLEGSRFVIHNPNAQSTCGCGSSFSV

    >gi|91778665|ref|YP_553873.1| HesB/YadR/YfhF, Iron-sulphur cluster assembly protein IscA [Burkholderia xenovorans LB400]
    MAISLTPAAARHVEKSLRKRGSGMGLRVAVRTSGCSGFAYALEFVDTANDEDQRFEAHGVTVVVDPRSLTMLDGTELDFV
    REGLNEGFRFHNPNARANCGCGESFAV

    >gi|91778679|ref|YP_553887.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MEQRLDFYKANPAAIKALLGVEERIGKSALEKSLAELVRLRASQINGCAYCVDMHTTDARNGGETERRLATVVVWRETPF
    FTDRERAALEWTEALTLVSLDHVPDAVWTAVRPHFSEAELVDLTLLISAINAWNRFAIAFRKLPA

    >gi|91778768|ref|YP_553976.1| putative thioredoxin [Burkholderia xenovorans LB400]
    MATQTAYSSTAPSRAELDALPGATIVEFGTDWCGYCQGAQASIAKALEPHAHLRHLKIEDGPGRPLGRSFKVKLWPTLIL
    MRDGAEVARVVRPANATQITEAFASL

    >gi|91778892|ref|YP_554100.1| AhpF [Burkholderia xenovorans LB400]
    MLDANLKTQLKTYLEKVSRPIEIVASVDDSAKSQELLALLNDIATLSERVNVIERRGDAERKPSFSIGEPGKETGIRFAG
    IPMGHEFTSLVLALLQVGGHPLKLEDAVIEQIRNLDGDYQFETYFSLS
    CQNCPEVVQALNVMALINPRIRHVAIDGALFQ
    NEVEARQIMAVPTMFLNGEVFGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKSYEVDIMDVQRAEALIPGRINEVRLANGAVLKAKTIILATGA
    RWREINVPGEREYRNHGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLA
    NVTVVTQAQTTEITGDGKKVNGLVYKDLRSGEVKQVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLSAFDYLIRNSEEVEVVSEAEAEVAV

    >gi|91778893|ref|YP_554101.1| hypothetical protein Bxe_B1205 [Burkholderia xenovorans LB400]
    MPIINSQVKPFKAQAYHNGEFVTVTEESLKGKWSVFVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYSVSTDTHFTHK
    AWHDTSDTIQKIKYPMVADPTLAISRNFDVLIEEEGLALRGTFVINPEGEIKVAEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|91778943|ref|YP_554151.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MLNWIDYRQELFGRIGEIAKLSPDTVRGYQAISGAGQKKDLLGARTRELIALAVAVSLRCDGCITVHTAEALKHGATRDE
    IAEALGVAVAINAGAAMVYSARTMDAAAAYAAEAADAGQAAG

    >gi|91778953|ref|YP_554161.1| putative OsmC-like protein [Burkholderia xenovorans LB400]
    MKRKASAVWQGGLQDGKGSISTDSGVLKETQYSFSTRFADGIGTNPEELIAAAHAGCFSMALSAELGKAGITPERIGTTA
    TVTLDKDGGGFAITAVHLDVAVKIPGGDKAAFEKATADAKAG
    CPVSKVLNATITMDAKLET

    >gi|91779070|ref|YP_554278.1| putative transmembrane protein [Burkholderia xenovorans LB400]
    MSIDLASFTPGLSLTGGLLIGAAAAALVLFNGRIAGISGILGGLVGTPQKDAQWRVAFLAGLIGAPVLAGLLGSRIAPDI
    QAGWGEILVAGFLVGIGTRYAGG
    CTSGHGVCGISRGSIRSVVATATFMASGFLTVFISRHLLGG

    >gi|91779146|ref|YP_554354.1| alkylhydroperoxidase AhpD [Burkholderia xenovorans LB400]
    MAKLQPISRYPVPEPGQWPDDIRARILEVQEKAGFVPNVFLTLAHRPDEFRAFFAYHDALMLKEGGLSKGEREMIVVATS
    AINQCLY
    CVVAHGAILRIYEKAPLVADQVAVNHRKADITPRQKAMLDFAVKVCSESGTVGDADFQTLREHGFSDEDIWDI
    AAITAFFGLSNRMANVISMRPNDEFYLMGRVPKAAAADTPRK

    >gi|91779147|ref|YP_554355.1| putative transmembrane protein [Burkholderia xenovorans LB400]
    MSVLVTQLGVPIPAAPMLILGGTMAAMGQTSYASVVCAAVGATLIADSLWFFTGRAYGRRLLNSLVRFSLSLDTTVRVAR
    NTYERYGAPILTVAKFLPGLGLISAPLLGTTAISVGVFLLWDFIGAVLWAGVWVIGGGALHDQIVQLLLLVRQNGGTIFD
    AFAVIFVAVLLYRWVRRWQFRRWLAHTRISPEQLDELMRSNEPPLIFDARPRSVREKESHRIAGARPLDLDSPEPIDPEL
    LKRPIVVYCV
    CPNEATAKRIVNQLHRKNIHHIRALKGGLDAWEKRGYPVEPLPPDFHTAKAHMLEDEGEEGEYTVRARLA
    K

    >gi|91779279|ref|YP_554487.1| peptide methionine sulfoxide reductase [Burkholderia xenovorans LB400]
    MRTINTGIASLRKRFSVTRLTGLVVVALGVAAAQHLAHSAEAATKIPAPMQDEKAAATHSETAVFAGGCFWGVQGVFEHV
    RGVKEVASGYSGGAASTAQYETVSEGDTGHAESVRITYDPTQITYGRLLQIFFSVAHNPTELNYQGPDHGTQYRSAIFPV
    NAMQRGIAQSYIAQLDNAHVFSAPVVTRVENFKGFYPAENYHQNFLALHPDYPYIAINDLPKVADLKRMFPDLYRNDPVL
    LATSAQ

    >gi|91779280|ref|YP_554488.1| putative transmembrane protein [Burkholderia xenovorans LB400]
    MLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRSGLPLLAGMALTFAIVATLAAVGGGWVTQANQYGRWLAIALLA
    IFGLTLLFPRFADHLMRPLVRAGNRLSDFAQADGQQIRAGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LAAYAAGAATSLAVALLIGGKVFTAMKRSLGAGEWIRRGIGVAMLGGVAAIALGFDTGVLARVTTVATGGLEQRLVDKLS
    PNTAASTSPVAGNPSDISGSGAMKSAGPATGSATNTEPAAAAMSGGAMMRAVANVAPLPVEGVLPPLDGAVQWLNSPPLT
    LQDLRGKVVLIDFWTYS
    CINCLRSLPYVKAWAQKYKDQGLVVIGVHAPEFAFERNIDNVKKAVHDLGVDYPVAIDNNYAI
    WRALNNQYWPAHYFVDARGQIRYHHFGEGDYAESEKVIQQLLTEAGHADASKVAIGIANAGAQGVQAAADNADMQSPETY
    VGYQRAENFASPGGEVEDRTHTYAAPSQPGVDEWGLAGSWNVGAEHATLAAASGRIVYRFHARDLHLVLGPGKDGKPVRF
    RVSVDGAAPGASHGTDIAPDGSGTVTGQRLYQLVRQSGEVADRTFSIEFLDPGVQAFAFTFG

    >gi|91779456|ref|YP_554664.1| putative DedA-like transmembrane protein [Burkholderia xenovorans LB400]
    MFLNVLLTRLGVPIPAVPVLLFAGSAIAAGTLSFWPILGAAVLGALIGDGAWFTAGRLYGRKLIAALSRLSPAIDPKVNK
    ARALFERFGVPLVSISKFVPGLALITPPLMGTTAVDARIYAAWDLASALAWGSFWLLGGAAAERQLHMLLDFVKARGGTV
    IDVLLAAALVYLAFRLQQRRRERRRFADAAAVAAAEAGGGGWRRIAPPKVLDARPQTPSLEAPRRIPGALALDPHSPEQI
    DGALRAHDMVIYCI
    CPDSATAVDITQRMRHNGYTRIRALRGGLDAWQRRGFPVEPLAPADELSTGKRAPQPRGDARGAIT
    LRGFAPRSGQST

    >gi|91779528|ref|YP_554736.1| methionine sulfoxide reductase A [Burkholderia xenovorans LB400]
    MTTQTETALLAGGCFWGMQDLLRRYPGVLSTRVGYTGGDVPNATYRNHGTHAEALEVVFDPRQISYRQILEFFFQIHDPT
    TKNRQGNDVGTSYRSAIFYLDDEQKRVAENTVADVEASDLWPGKVVTEIAPAGPFWEAEPEHQDYLERIPNGYTCHFVRP
    DWKLPKRG

    >gi|91779534|ref|YP_554742.1| methylated-DNA-(protein)-cysteine S- methyltransferase [Burkholderia xenovorans LB400]
    MTYAYKLMDSPVGQLKLVANGERLAAILWQNDKPNRVRLGELIEANDRPVLIDTERQLNEYFAGTRREFDLPLAFQGTEF
    QKQVWAALLTIPFGQTRSYAEIAVQIGNVNAVRAAGAANGRNPISIVAP
    CHRVIGASGDLTGFAGGLANKMFLLSLEAGQ
    TSLEAQADRQTDMFAEEGKAKVEAQARPEAQTKPARHAPRRGTQSSLFGT

    >gi|91779638|ref|YP_554846.1| hypothetical protein Bxe_B0451 [Burkholderia xenovorans LB400]
    MQTATHAKIKVFWQPGCSSCLRTKEFLANQGIEFESIDVHNDPDGLAQLTALGARSVPVVALGSKFTFCQSINDVIKFLD
    LKTKIITPLPPAELVSRLELVLESNARYTRQFSGPAFREPFRNRNRTPAGLTFHVFRVAEMGIEAAQQIELLFEGFDEVP
    PTHWGPDDIAQWGESVKARLTAWWNDETDRSLSYDVPTYYGRRPMHEVLERTAWHSAQHTRQVMLMLESEGIQVDRPLSA
    QDLAGLPLPDEVWDR

    >gi|91779673|ref|YP_554881.1| putative dithiol-disulfide isomerase [Burkholderia xenovorans LB400]
    MTQALTIDFVSDIACPWCAIGLSSLQLALSRLGDAVDARIVVHPFELNPDMGPDGETIVEYLGKKYGRTPEQIAETHAAI
    RERGASVGFTFGPRTHVYNTFDAHRLLHWAGIKGEQLPLKLALLRAYHSEGKDTSDHEVLIEAAQSVGLDAAQARDVLQN
    GTYAAEVRAEERNNEAMGIQSVPAIIFNRRYLVSGGQPVETFEQVIQQILAEAKNDALQDT

    >gi|91779736|ref|YP_554944.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MDEARQACHPTHSRRRIMETNYPERHHELQTVLGKMRREIAGPMSGFEHLHKEAVAGGELSGKHKELIALAIAIALRCDD
    CLAWHVHDAMRAGASRQEILETVSVAVMMGGGPAVVYACHVFDAIEQFEGRDGGLPSASGFLSAGVGRGAA

    >gi|91779786|ref|YP_554994.1| arsenate reductase [Burkholderia xenovorans LB400]
    MSVTIYHNPACGTSRNTLAMIRNAGIEPEIIEYLNTPPDRETLIGLIARAGLTVRAVLREKGTPYAELGLNDTSLSDDAL
    LDAMMEHPILINRPFVVTPLGVRLCRPSEVVLDILPVGQKSSFRKEDGEQVVDSEGRRLP

    >gi|91780069|ref|YP_555277.1| arsenate reductase [Burkholderia xenovorans LB400]
    MITIYHNPRCSKSRAACELIADTYNSANEATEIVEYLKHPLTVDQLKQLTAQLGCAVREMIRDTEAEYKELQLSDATLTD
    TQLYEALAKHPILLQRPIVVRNGRAVIGRPPEKVAALFA

    >gi|91780160|ref|YP_555367.1| alkylhydroperoxidase-related [Burkholderia xenovorans LB400]
    MNRTHGFTAATLEWTAWLDTVALDKASPEQTAVLEASHPKASTSDYYLLLVHEPEVLAQRSGAFNSIMYAPGGLSRAERE
    LASTVVSRVNGCVY
    CASVHAQRFTQLTRRSDVIEQVFADPATAGTNERERAIVRYAIDLTLHPEAVDRRSLDALRVVGLT
    PAEILDLSQAIAIFAWANRLMLTLGEPVFPQ

    >gi|91780172|ref|YP_555379.1| alkylhydroperoxidase AhpD core [Burkholderia xenovorans LB400]
    MDSGALSCAWPSTTMNALLQGSDMSRLPLQTLESAPAASRPYLARAQAANGFLPNLVASLANAPAALEAYLTVAEINGRG
    SLTLAERETVQITAAGIHGCGF
    CVAGHTAVALKKAQLEPALVDAIREQRTLSDSRLDAVAVFTRAVIATRGAVADEQLAA
    FHRAGFSDAHALEIVLGVSLATLCNFANNLAQNELNPQLAAYRWEASAHAA

    >gi|91780188|ref|YP_555395.1| rhodanese-like domain-containing protein [Burkholderia xenovorans LB400]
    MTLEVAERPTHTLLEAARTRATEAGLPYAGGLAPQDAWALVQTGNALLVDVRTAEERKFVGLVPGSLHVAWATGTSLTRN
    PRFVRELEARTGKDAVVLLL
    CRSGNRSALAAEAAAKAGFTQVFNVLEGFEGDLDGAQRRGSSNGWRFHGLPWIQD

    >gi|91780425|ref|YP_555632.1| periplasmic protein thiol-disulfide oxidoreductase DsbE [Burkholderia xenovorans LB400]
    MKRVFVPLIGFAVLVAVLAAGLRHDPRRLPSALIGQPAPSFDLPGLGATDKRVSPQVLRGQVWILNVWASWCESCRDEHP
    LLVDLAARRIAPVYGMDYKDERAPALQWLAEAGDPYTASFVDHSGQTGIDYGVYGVPETFVIDRAGIIRYRHAGPLTRQS
    LDGVILPLVRQLQHEDINGS

    >gi|91780875|ref|YP_556082.1| dihydrolipoamide dehydrogenase [Burkholderia xenovorans LB400]
    MDDHYDVIVIGGGPGGYVAALRAAQLGRRTALCERDQLGGICLNWGCIPTKALLHTADTLRTVRKAAHLGIGIDDPVVDF
    TRVMARSREVAQKLNRGVSHLLRKAGVTVLAGTAAFAADRSVRVHGADGALRTLQARHTIVATGAAARQLPALPWDGERI
    WTYREALAATAVPKSLLVVGAGAIGMEFAGFYAAMGTEVTVVEVAPRILPASDADVSEFVARACERDGIRLRTGCSVVHS
    AAHAEGVRVMFRSENAEEQREFERVLVAVGLDGNTEGLGLEHTRVAFERGLIIADAAGATSDPVVHAVGDVTGAPMLAHK
    ASHQAIACVERIAEVNRGERHASPKIPGCVYSHPQTASVGLTEDEARRTGRALRVGRFPLDANGKAIALGDPSGFVKTIF
    DAASGELLGAHIVGPEAPELIHGFTLAATLEATESELIETVFPHPTLSEAMHESVLAAFGRPLHI

    >gi|91780949|ref|YP_556156.1| putative rhodanese-like sulfur transferase [Burkholderia xenovorans LB400]
    MTILSLVEISDLPRLLQHAVILDVRSHDAYWQGHLKGALRVEPSLAALPKTDRASVQQYDSRLQWLLSTLGVQTGSTVLI
    YGETLDGGVARVAWALDYAGLARVTVFNGPFEALRGVELETIGPQTTAVNLTLNPRRHLLATASGLSANLADATTRVLDA
    RELDDYRGTRANPARRGHIPGALHWDNRQEVSADGRIDTPTVLAARFGALGLEPGQPIATY
    CGSGPRASRTWLALRHAGY
    TNVSVYQASWGEWGASAELPVEVDGERAPAVE

    >gi|91781139|ref|YP_556346.1| putative rhodanese-like sulfur transferase [Burkholderia xenovorans LB400]
    MADTFPLITAPTLREWLNDRSEIALFDVREAGEFGEAHPFFAIPLPYSRLELDIERLAPRRNVRIVLTDGGSQAEVTARR
    AARRMQALGYTHVSILEGGVRGWAAVGYTLFKGVNVPSKTFGELVEHACETPRISASELARQQHERVPLVLLDGRTVEEH
    TKMTIPGAVSCPNGELAYRIGPLATDPRTPIVVH
    CAGRTRSIIGAQLLRNLGLPNPVIALENGTQGWALAGLTLEHGSTR
    RYPDAVDESSLAQARRRAAALATRFSITTLGARTAQAWLAATDRTTYLLDVRSAEEFARDGVPAAVHAPGGQLLQATDQT
    IGVRRARVLLVDHDAVRAPVIATWLAQMGIESALVVAQDAASLQRPAPRARQPAVPQADLIDADGLRELNGASIRHLIDL
    RSSAAYRKQHPAGARWSIRPRLLDTLASSGARASDPVVLFAETPEFAALAALDLREAGFTAVRIAAKGVGSWTEASLPLD
    SSPGIPADSERIDHLFFVHDRHEGNLDAARAYLAWETGLIAQCSPDELDHFNIDARIETKAFNAAFSR

    >gi|91781216|ref|YP_556423.1| putative mercuric reductase [Burkholderia xenovorans LB400]
    MTTLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIEAGTSSDALTTAVAGLGYEATLADAPPTDNRAGLLD
    KMRGWIGAADKPSGNERPLQVVVIGSGGAAMAAALKAVEQGAHVSLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIAATVPAIDRSKLLAQQQARVEELRHAKYEGILDGNPAITVVHGEARFKDEQSLVVRLNDGGERVVAFDRCLVAT
    GASPAVPPIPGLKESPYWTSTEALVSDTLPERLAVIGSSVVALELAQAFARLGSQVTILARNTLFFRDDPSIGEAVTAAF
    RAEGIKVLEHTQASQVAHVNGEFVLTTGHGEVRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIVIDKGMRTSTPHIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDAAINLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALAN
    FDTRGFIKLVIEEGSGRLIGVQVVAPEAGELIQTAVLAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSC
    CA
    G

    >gi|91781218|ref|YP_556425.1| periplasmic mecuric binding protein, MerP [Burkholderia xenovorans LB400]
    MKKLFASLALAAFVAPVFAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKAT
    EDAGYPSSLKR

    >gi|91781219|ref|YP_556426.1| putative mercuric transport protein [Burkholderia xenovorans LB400]
    MSEPQNGRGALFAGGLAAILASACCLGPLVLVTLGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIVRPTAACKPGE
    VCAIPQVRTTYKLIFWFVAVLVLVALGFPYVMPFFY

    >gi|91782239|ref|YP_557445.1| hypothetical protein Bxe_A3596 [Burkholderia xenovorans LB400]
    MPRLPFASHTATPLINILSHAPEVAKRWRETNEFLRMGGQIDPDLKEEVRRAVAQEAGCRFCATVSGAPKGHYDDVRVAA
    AVRFATVVASHPKGIADSDFDVLKEHFSLAEIVELLAWICYNYGAEMLGAMLDLDDASEAEQKFYASYLERLKKRANIAA