Burkholderia vietnamiensis G4 uid58075

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|134287674|ref|YP_001109840.1| protein-disulfide reductase [Burkholderia vietnamiensis G4]
    MRTTSSNAYQSDYQTADILSRILRFALVLLLGPASFSAYAVNESELLAPEQAFPLTVSLASPMEVVLDFKTKPGYYLYRD
    RISFAVDGTLVKPDSMPPSESKNDPTFGVVQVYHQPVRIRLPLSAAITSSAMLTVTSQGCADVGVCYPPQTRRFRIAADG
    AVTLAALVGSANAADFPVVEKSRQSAVPGLPLRPANGIGIAELLGFLVAGLLMAGTVCMYPLIPIVTAVINGTRERLPVW
    RGVSLSFAYVQGLAMTYAAAGTIAAVVGIPLVAVTQKPWLLATFGALMLILALGMFGVFRLQLPTGWQTRFAGWSRRLPG
    GRVGPVFVMGMLSALIVGPCSTTALAGALVYIANSHDIAGGTLALYLMGIGIGIPLLLVGTFGTRLLPKSGHWMVAVQNT
    LGVMLLAAALWFVYSLLPVWLLMSLVALLLTACGMMLRAIDPLPAGATGIARVGKALGVLLLVAGIAEFVGVASGNFDML
    MPLGGLTRMSASAGGGASSAARFDTITSNAKLDEALKLARGTPVMVDFYADW
    CITCKELERFTFTDARVMDEFTHWKLLR
    IDVTKNTEADTAMLRRFGLFGPPALIFFDKTGREQPDAQLVGFIGADAFLAHLKRLQSSDVAQ

    >gi|134287752|ref|YP_001109918.1| methyltransferase type 11 [Burkholderia vietnamiensis G4]
    MDFYNNVILPRLCHLAMRNRRLVPYRERVIGGAEGRVLEIGIGSGLNLPFYRAPVSEIVALEPAPPLIAMARRSVQPTAM
    RVSFIEGSAEAIPLDDHSIDTVVTTWTLCTIPQVANALGEMRRVLKPGGRLLFVEHGM
    CISGGCHLNRPIQTIIERAGFR
    CDRLETGYMPGPKPMAFIYEGSVRPD

    >gi|134287763|ref|YP_001109929.1| heavy metal translocating P-type ATPase [Burkholderia vietnamiensis G4]
    MQDEHIAHHSHPEAPAGGAIEAAKEDVTDPVCGMRVSSATARSIEFKGTTYYFCSTKCGDAFRAEPTKYVHVSDRPQPAP
    VRKPGVVYTCPMHPQVRQPAPGN
    CPICGMTLEPVMPAATGERNPELESMTRRFWVALVLSIPLLWITTGAMLPSLDLGAL
    INRLGANLAWPHLMSVTWAQCAQALLATPVVLWAGWPFLERGWRSFVTWQLNMFSLIGLGVAVAYAFSLFALFFPAQLPQ
    AFRQGNDLPLYFEAASVIVTLILLGQVLELRARSRTSSAIRDLLSLAPNTAFRVNADGTEEEVGLDAVAVGDVLRVKPGS
    KVPVDGVVIEGQSSIDESMITGESIPAEKGPASKVTGATVNQTGSFVMRAEKVGAETLLARIVQMVADAGRSRAPIQKLA
    DKVSGWFVLAVLGIAALSFAVWALVGPAPALAHALVVAISVLIIACPCALGLATPVSIIVGVGRGAKEGVLIKDAEALEL
    MEKVDTLVVDKTGTLTEGKPQVQAVEVLAGMSEADVLSYSASLEGLSEHPLAQAIIARAKAAGAAIREVRDFAAVPGKGV
    AGNIDGHAVSLGNARLMEDNLVDLAALGERAETLREQGQTVMYLAVDGKPAGCIGVADSVKGTTPEAIRLLRASGVKIIM
    LTGDNPVTANAVAKALSLDGVKAGVLPQDKYKHVQELQNQGRVVAMAGDGVNDAPALAQANVGIAMGTGTDVAMSSARVV
    LVKGDLRGIAKARALSVGTMKNIRQNLFFAFAYNVIGIPIAAGVLYPWLGILLSPIIASAAMALSSVSVIGNALRLRAAK
    V

    >gi|134287890|ref|YP_001110055.1| hypothetical protein Bcep1808_7653 [Burkholderia vietnamiensis G4]
    MKSNDIIRPFEKSLFVQFGSTGELQHVSTLRLDQGVTFIRSGNTIEARYHDGAGEALVVERFSSESLATTAFQNLQAALK
    RYARVRRFAGFWKAAIKWGFAPLMVAVLGLAVNMAATRAVGGSPAGGIGAAGAASMVPLPNNLGALQQPIARPAVASPAQ
    LAQAMADGAKSGKYAVQFSKGNKGTLYVFSDPS
    CPHCQDLEPELDKLAKDYTIYIFPVTVIGGEASSHRTAKLMCAKPEA
    RAALWKKIVQGDDLPNAECADGSDAVARNDQMFRVMRFLGTPTIINAAGEQTPDSIPNTADAINQWMSAAATARK

    >gi|134287954|ref|YP_001110118.1| hypothetical protein Bcep1808_7353 [Burkholderia vietnamiensis G4]
    MKKTLFAGMAALAVTQAFADGPSVPAGVERPAFFASSDIKVLDFRKGPGGLNVWSVERNGVQTVLYTTADNKVLMSGVLW
    DAKSGVNLSDAFLKPSMIQSASAQAAESNGAPARAKAGAPSTPIAAVAALRGIKEGSGAAEKTIYILFDPR
    CPHCQNVYR
    DTRNFVKNGGSIKWIPTTVLGRDQMGTAMVADILQSRNPIEAMGRVESGGFRQPGKIEQSTLDAIRDNEEYFWAAFDRNK
    GAGTPGVPVAFFQTSDGAPQMVANLDDRELLNRIFKDMSK

    >gi|134288074|ref|YP_001110238.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASWYAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAA
    TLAQLGFAASYLEGGFAQWLADGLPVTSHTPGNPS

    >gi|134288171|ref|YP_001110334.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASWYAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAA
    TLAQLGFAASYLEGGFAQWLADGLPVTSHTPGNPS

    >gi|134288227|ref|YP_001110390.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MMQNWNNYRTALLERIGDYAKQSPDVLRGLATIESAAAKSGKLDPKIHELISLAVAVTTRCDGCISVHTKKAVEHGATLE
    EISEALGIAIAMNAGPALVYSARVLEAHAQLTNS

    >gi|134288276|ref|YP_001110439.1| periplasmic disulfide oxidoreductase,DsbA type [Burkholderia vietnamiensis G4]
    MQQASTQSQLPYREVAPKAEDSKKALIFISFTCPVCAGYHEQLAKWAKSLPPGWKAEFVPVVEPQRDTVIAARAFYAAKL
    VNASYVPTWMTYAFSAIQDRGMPVEDGKTWDYIARSSHLDGFDEAWKKVDEKSLRDAFDKLVSYRIDATPSIAIGGRYVI
    TPDNTNGDQELFFKLANGMVSKSMN

    >gi|134288555|ref|YP_001110718.1| protein-disulfide isomerase [Burkholderia vietnamiensis G4]
    MKKFAAALLLAGLSVAAFASPETDSVLATLKSKYPNTNFTSIEASPLPGIYELTMGKNIAYTDKEGHYFLFGSLYDMEKR
    QDLTAPKREAASKIDVSKLPLKDAIVRVKGKGTRKLYLFTDPD
    CPFCKELERDTLPKLDDVTIYTFMFPLDSLHPQARAK
    SESIWCLPEKERGAAWDKLLTTGTPPAMAKCDNPLAALSSLGDSLGVRGTPTMFSEDGRILPGAAAPERIDAFLNAGK

    >gi|134290945|ref|YP_001114714.1| methionine sulfoxide reductase A [Burkholderia vietnamiensis G4]
    MIPTSTRISVAPRRAALLRRLAALALAAAAVFGYQRVVRSAEPIHNAPAPTLDETPGASHDETAVLAGGCFWGVQGVFEH
    VKGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVYDPAQVSYGRLLQLFFSVAHDPTELNRQGPDEGPQYRSAIFP
    TNAQQHAVATAYIAQLGAAHTFAAPVVTRVEPYQGFYPAEDYHQNYLELHPDAPYIAFNDLPKVAALKQRFPALYRADAV
    LWHDARR

    >gi|134290946|ref|YP_001114715.1| cytochrome c biogenesis protein, transmembrane region [Burkholderia vietnamiensis G4]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLIGMALTFAVVATLAAVGGGWVAQANQAGRWLAIVLLA
    LFGLTLLLPRFAEHLTRPLVAAGNRLTGLAQRDGRAAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGANVGTTLL
    LVAYAAGAATSLAVALVIGGKVFAAMKRSLGAGEWIRRGIGVALLAGVGAIALGADTGALAQLSTVTTGSLETKLVARLG
    GHSNGAPPAQPGADDGRDGLAGRSGAMMAATSAPTPDAGGAMMRAADPAPATHAAAALPVEGTLPSLDGAVQWLNSPPLT
    AAGLRGKVVLVDFWTYS
    CINCLRTLPYTSAWAHKYARYGLVVIGVHAPEFAFERNVGNVKKAVHDLGIDYPVAIDNGYAI
    WRAFDNEYWPAHYFVDAQGRIRHHHFGEGEYAQSERTIQALLADAGHPEALNVPLGLTGAPAQGALAPADGPEVHSPETY
    VGYARAQAFASPGGVVRDAAHRYDAPSRLDLNDWGVAGTWQVGGERATLAAPGGRIVYRFHARDLHLVLGPGAHGKPVRF
    RVTLDGAAPGAAHGADVDAQGYGTVSGQRLYQLVRQPGVIADRTFSIEFLDPGVDAYAFTFG

    >gi|134290947|ref|YP_001114716.1| methionine-R-sulfoxide reductase [Burkholderia vietnamiensis G4]
    MPTRRHLLFAGATGVAALAALSSAGRRMLVGRAFAAPPGARGATASFDVTRSEAEWRRRLTPAQYTVLRDAGTEPPYSSP
    LNGEHRRGTFACAGCDLALFPSSTKFDSHTGWPSFWKPLDHAVATEADASYGMARTEVHCRRCGGHLGHVFDDGPPPTGL
    RY
    CMNGLALAFHPAAA

    >gi|134291054|ref|YP_001114823.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MSRLTTIRPEEATGAAAEVFAKIKKAVGKVPNAYATIGTHSPEALGAALAFDAVVAAGTLGKADIEVIKLAVSEHVGCDY
    CVAAHTLMGKLAGLSSDAMKQVRVGAATGDAKRDALVTYVRTLVGTRGTVPEAAVDAVRAAGYTERQLIEISLAIASITF
    TNLVNRVNDTTLDFPAVA

    >gi|134291401|ref|YP_001115170.1| iron-sulfur cluster assembly accessory protein [Burkholderia vietnamiensis G4]
    MAISVTPAAARHIEKALQKRGAGLGLRVAVKTSGCSGFAYALEFVDAPNDDDLCFATHGVTVVVDPRSLPMLDGTELDFV
    REGLNEGFKFHNPNATANCGCGESFAV

    >gi|134291402|ref|YP_001115171.1| iron-sulfur cluster insertion protein ErpA [Burkholderia vietnamiensis G4]
    MELLQPSADAAPVPLPAFLDFTPNAAAKVAALIDAEGNPQLKLRLYVSGGGCSGFQYGFAFDDQVADDDLQVVTDGVTLL
    IDAMSRQYLAGARVDYEDGLEGSRFVIQNPNAQSTCGCGSSFSV

    >gi|134291407|ref|YP_001115176.1| iron-sulfur cluster assembly accessory protein [Burkholderia vietnamiensis G4]
    MLPNVTITAAADKFMRRIVRFSGLPAGAGFRLVVSAGGCSGYNAAFSAEAAPQAGEAVLDADGLRVFLPAESRMLLDGVT
    IDFVETATQSGFTFTNPNQAPCACSSAAPAEPGVAKIGIDAIGRGRPPELSRAS

    >gi|134291420|ref|YP_001115189.1| nitrogenase-associated protein [Burkholderia vietnamiensis G4]
    MAHVTFYEKPGCGGNAAQKALLVAAGHTLEVRILLRWPWTPKTLFAFLEPLPVHEWFNRAAPDVKAGRIVPEALDAAAAL
    ALLLAEPLLIRRPLMEAGDGRMVGFDAARVHAWIGLGPLTAADAPPGSLEGCAAATTGCAAASA

    >gi|134291506|ref|YP_001115275.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASWYAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAA
    TLAQLGFAASYLEGGFAQWLADGLPVTSHTPGNPS

    >gi|134291585|ref|YP_001115354.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MMDDSMYPQWTAEIATRRRELAPEALAAFRAFNSSVFGDGALPAKTKQLIAVAVAHVTQCPYCIRGHTKEALKAGASENE
    IMEAIWVAAEMRAGAAYAHSALALDVMKQEGQSREARHDEHH

    >gi|134291682|ref|YP_001115451.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MTDSLNYRQRTAEITEQMRKLRQSQPDLMSAFGALAAAGTRDGALTKKTRELIALGIAISSRCDDCIGFHVQALIKLKAT
    REEVEEVAGVAVYMGGGPSMMYAAHALIAYDQLAA

    >gi|134291987|ref|YP_001115756.1| OsmC family protein [Burkholderia vietnamiensis G4]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRETAQTLIDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|134292233|ref|YP_001115969.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MLPRFRTAVAVVAVAATAALAAFAGTRDDAKLPASAAGMQAPNFTGIERWHNSAPLTLDQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRRYRDQGLVVVGVHTPEYPFERDADNVADALERFGIRYPVAQDNHYDTWRAYGNQYWPALYLIDASGKVVY
    TRYGEGGYDTTEAAIRAALAQAHAATDAMQRATRTQ

    >gi|134292303|ref|YP_001116039.1| selenophosphate synthetase [Burkholderia vietnamiensis G4]
    MTEATLTPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGEAVCAEAGIPVAGGHSIDSVEPIYGLAAI
    GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDAAGYAQMLATTTKLNRPGAELAALSGVHALTDVTGFGLL
    GHTLELARGAGLTARVHYASLPWLAGVEAFVADGVFTGASGRNWAAYGADVRLADNLPPVAQALLTDPQTSGGLLVACAP
    EAVDDVLACFRADGFDRAAVIGEMVDGASRVEVA

    >gi|134292314|ref|YP_001116050.1| uncharacterized peroxidase-related enzyme [Burkholderia vietnamiensis G4]
    MTAADHAPISRFPVPALDDLPDDIRARIAAVQEKSGFIPNVFVTLAHRPDEFRAFFAYHDALMDKPGNLSKAEREMIVVA
    TSSANQCQY
    CVIAHGAILRIRAKDPLIADQIATNYRKADITARQKAMLDFAMKVSQAAHEVGEADFDTLKSHGFSDDDAW
    DIAAIAAFFGMSNRLANVTNMRPNAQFYALGR

    >gi|134292363|ref|YP_001116099.1| beta-lactamase domain-containing protein [Burkholderia vietnamiensis G4]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALVDELGLRLVATIDTHVHADHVTGAWLLKQRAGSTIAIS
    AASGAQGADRYLNDGERCRFGGRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDVQAAP
    DWAPLVYTFAGFWEIDPQWLEDHLRTVQVVDVREPDEFTGPLGHLPGATPIPLGELAARTGELEHTRPIVTV
    CRAGGRSA
    QATVILRKAGFDAVANLGGGMLRWRSEGRIVADGRA

    >gi|134292379|ref|YP_001116115.1| heavy metal translocating P-type ATPase [Burkholderia vietnamiensis G4]
    MTESLASTATHTIELDIDGMTCASCAGRVEKALAKVPGVARASVNLATERASVAATMDVGATQLADAVRQAGYGATPVAG
    EPTASAQPAAAPQAPAPASIELDIDGMT
    CASCAGRVEKALAKVPGVTRASVNLATERASADAAPDVSASRLVDAVRQAGY
    GATPVAATPTADRAGPASFELDIGGMT
    CASCAGRVEKALAAVPGVARASVNLATERASVQAAGTLDAAALIAAVTSAGYQ
    ASLAAEAQAAAAGPAAADPAQTTDARKRRDAIRERNLVIGAAVLSTPLIVPMLVAPLGIDAMLPGWLQLVLASIVQFGFG
    ARFYRAAWHAVKARTGNMDLLVALGTSAAFGLSLWMLLREPAHPGHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRAL
    NALRPDRARIVEHGVERDVPLAQVRVGTTVAIRPGERVPVDGRIVSGRSHVDESLITGESLPVPKDDGDPVTAGSINGEG
    ALVVATTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPSILGIAVLTLTGWLIAGAGAETAILNAVAVLVIAC
    PCALGLATPAAIMAGTGVAARRGVLIKDAQALELAQRATVIAFDKTGTLTEGKPSVTAFDAVDISREQALAVAAAVQRHS
    DHPLARAVVAAYDADVAARGGAAVAADAAAATDARAVAGRGVEARVDGRLVALGSSRWRDELGIAVPPELGARAAELERA
    GNTISWLMRADAPRALLALIAFGDTVKPGARDAIAALSARGVASVLVTGDNRGSAAAVAAALGIDEVHAQVLPDDKARVV
    AELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPTLVADAIDISKRTYRKIQQNLFWAFVY
    NLIGVPLAALGWLNPVIAGAAMAFSSVSVVTNALLLRRWKGKAR

    >gi|134292408|ref|YP_001116144.1| thioredoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MKTVLRNLTAACLIVVTGAALAVDTPQRVAVAGAPSGDAHLPPGIAWQQGDVDAAFALAKRTGKPLLLYWGAVWCPSCNQ
    VKSTVFSQQAFKTRSSLFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTATHP
    VRQTLATALNEGAALTPSEWHLLADYSWDTDGALPVPPDRVAVTLQTLSQRARAAGATADAARFALKAAVVAASDDPAQA
    GALDKAALADALRDVLRDPPLARADSDVLVAAPARVVAYLGGEPAQRTKLRGAYDAALARLSTDATLSAIDRLMALHGRV
    LLARGDARDGTRLDTAAPALLTAARKQIAASVQGAANAYERQALVSEAADTLTDAGLYDESDALLKAELPRSSTPYYFMS
    GLAANAKARGDKAAALDWYRKAYDAASGSATKLRWGATYFANAVALAPDDSARIEGIAASVLAQASGTRDAFYGANLRAL
    TKVVTQLKRWRSDGAHDASVRSVVKQFDGVCAKLPAGDPQAAACAKLLQPVKA

    >gi|134292414|ref|YP_001116150.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MLRDLVAQYGPLLVFANVLAAAIGLPVPAMPTLVLFGAMAAMHPAMIGSQVVTVLALSVLGALIGDTVWYVAGRRYGGAT
    LKTICRLSLSRDSCVRKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVALGAGLVFY
    RQIDWLFAGASRLGRAVLLVIVALLALYAAVRWMRRRALIRQLASARIGVDELERLLRDPSAPVVLDVRSAEHRKLDPFT
    IPGAQFADERHIDDIVARYPLTQKFVVYCS
    CPNEVTAALMARRLLDAGFTDALPLRGGLDAWRDTGRELASLLEETPAAN
    DPIAGLHKPA

    >gi|134292508|ref|YP_001116244.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
    MITIYHNPRCSKSRETLALVESLNVAGIPLDVIEYLKTPPTVEELEALHRQLGCAVRDMLRDGEEPYKTLDLGRANLTDA
    EAYEAIAAHPGLLQRPIVVYGGKAAIGRPPELVRALFE

    >gi|134292621|ref|YP_001116357.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MLSLGPFSIRVVAVAAAALLAWLVARLIQRRPRDGQHKSASSLILDVLLLGLVAARIGYVAQWWREYAATPRSIVALGDG
    GFDWRIGLATALVFAVWRLRRLPALRRPVAAGIVAGLAAWGIALGTLATLQRNAPTFAAMQLQALDGAPVLPQRFAGKPL
    VVNLWATW
    CAPCRRAMPILEQVQRDRPDITVLMLNQGESASAVRAFLAQQGLRFDTVLLDPTLRAMHAYGSRGLPTTLFF
    NAKGELVESHMGEITAARLKDAAAQRFGQ

    >gi|134292632|ref|YP_001116368.1| thioredoxin domain-containing protein [Burkholderia vietnamiensis G4]
    METEQRYTANAPTRAEVDALTGATVIEFGANWCGICAAAQPAIAASFAAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVF
    LRDGVEVARVVRPADATQIEADGFAALA

    >gi|134292668|ref|YP_001116404.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia vietnamiensis G4]
    MESPKQYEYLFLGGGKGGKSLAMDLARSGKRVAIIERGMIGGSCINVACIPSKTLIQNARNMHAWRSADATAHPVADMAR
    VHANVRAVVDGMVDVNRRAFEQSGLDLVIGSGRFVAPRRVAVRAADGSEQLFEGENVYINTGTVATIPDVPGLRDAAPLT
    HVEALGLDVLPARLIVIGGGYIGLEMAQAFRRLGSEVVVIHDAPRVAVREDEDVSIEIQNAFEADGIALRLSARIASVEG
    RSGTGVTVALADGTAVEGSHLLVATGRRPVTDDLGLDLAGVERDARGFIKVDDTLATTAQRTWAIGEVAGTPMFTHASFD
    DYRVLKAGIDGRGGSTASRVIPYALFTDPELARIGLNETDAKARNTPVIVAKLPMAAVPRARTNGTTRGFMKALVAPDSG
    QILGFTMVGSGAGEVMSAVQMAMIGKLPYTSVRDAILAHPLLAEGLNLLFATIK

    >gi|134292673|ref|YP_001116409.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MTRLTTLKPSEATGETAVVFNQIKAAIGKVPNAYATIGTHSPAGLAAMLNVDAAIAASSLEQADVEAVRLAVSALSGCDY
    CLAAHTMIGKMAGLAPDAMKQIRAGHATGDARRDALLAFVRSIVTSRDTVPAAVLDAVLEAGFTERQVIETILVVTSITF
    TNLVNRVNDTTLDFPAVD

    >gi|134292679|ref|YP_001116415.1| glutathione S-transferase domain-containing protein [Burkholderia vietnamiensis G4]
    MSTLQYHLVSHVLCPYVQRAVIVLTEKGVPFERTDVDLSNKPDWFLRISPLGKTPVLVVDGAPIFESAVICDYLDETLAP
    PLHPDAPLERARHRAWVEFASVLLSAIAGFYTAPDEATLAGKTRGIRARFQQLEDTLGTGPYFSGTHFSIVDAAFGPVFR
    YFDVFEQIDDFGFFAALPKVTAWRQRLAERPSVRAAVRADYPQLLMEFLLKRGSMLSTRIREHVLRVQD

    >gi|134292695|ref|YP_001116431.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia vietnamiensis G4]
    MTPALLIPSPLGDIAVRIEHDALTGLFFVGQKYYPSLAIAADEHAHVAASSLARHIADEVAEYFGGTRHTFSVPLQLNGT
    AFQRGVWQQLLAIPFGELVSYGDVTERLGLPMSAARAVGGAIGRNPVAIMVP
    CHRVIGASGSLTGYAGGIERKRALLSLE
    GARFVRGDRHAAQQAFAF

    >gi|134292757|ref|YP_001116493.1| uncharacterized peroxidase-related enzyme [Burkholderia vietnamiensis G4]
    MTTVTSHGFTSDTLGWRAWLDTVPLERATAGQLDVLEASHPHAKTSDYYLLLVHQPEILRQRSAVFNAIMYGPGGLSRAE
    RELASTVVSRVNGCMY
    CASVHAQRFTQLAKRSDSIEQVFEDPSTAGTNARERAIVRYAIALTERPDTVDDSDIAALEAAG
    LAHDEILDLSHAIAIFAWANRLMLTLGEPVFPQATTNT

    >gi|134292792|ref|YP_001116528.1| mercuric reductase [Burkholderia vietnamiensis G4]
    MTQHFDAIVIGTGQAGPPLAARLAGAGMKVAIVERGRFGGTCVNTGCIPTKTLIASAYAAHLARRAHEYGVSAGPVSVDM
    KAVKARKDAIAGRSNHGVEQWVRGLDHTTVLQGHARFEQADTVRVGDALLQAERIFINVGGRAQIPPIPGLDTVPYLTNS
    TMMDVDFVPEHLVIVGGSYIGLEFGQMYRRFGARVTIVEKGPRLIQREDDDVSQAVQEILAGEGIDVQLGANCLRARRDG
    ERVVVGLDCDGGGREVAGSHLLLAVGRVPNTDDLGLERAGVATDSRGYIAVDEQLRTNVPGIWALGDCNGRGAFTHTAYN
    DYEIVAANLLDDDPRKVSDRIPAYALYIDPPLGRVGMTLAQARQTGRRLLVGTRPMTRVGRAVEKGESLGFMKVIVDADD
    HALLGASILGVTGDEVVHGLLDVMAARAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|134292892|ref|YP_001116628.1| OsmC family protein [Burkholderia vietnamiensis G4]
    MSLIHAAATLAADASDYVVQLQAGTHALTGDEAPREGGQGVGPAPFELVLAGLAQCTAATLRMYMQRKTWPAARIDVRTE
    LHADREGQQYVRRVVTLDGPLDDAQRARLAEICEKTPVTQFVKRGTRIETTLN

    >gi|134292949|ref|YP_001116685.1| OsmC family protein [Burkholderia vietnamiensis G4]
    MNVLYKTSATSTGGRDGRAVSADNKLDVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKADAQALIDKAHHV
    CPYSNATRNNVPVRLTVI

    >gi|134292961|ref|YP_001116697.1| 3-mercaptopyruvate sulfurtransferase [Burkholderia vietnamiensis G4]
    MPHTHYTTLISAANLAERLAAAPGSVAVFDCRFDLADPAAGEAAYAAGHIPGAQYLHLDRDLSGRKTGTNGRHPLPSRDA
    LASLMASRGVKQGQQVVAYDAHGGAYAARLWWLLRWLGHDSVAVLDGGLQAWEASGQPLTTDVQHPAAGDFRAAAPLEST
    VDAAAVLANIASGARIVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLSTDGRFKTGHELRETFTALLAGVQPNSV
    ILQ
    CGSGVTACHNALALEIAGLHGASLYPGSWSEWSADPARPIATGPTP

    >gi|134293342|ref|YP_001117078.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia vietnamiensis G4]
    MLDANLKNQLKAYLEKITRPIELVASLDDGAKSQELLALLNEIASLTSRVTVIERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDFAFETYFSLS
    CQNCPEVVQALNVMALINPRIRHVAIDGALFQ
    DEVDARQIMAVPTMFLNGATFGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFAAALEQHVKQYDVDIMDVQRAEALIPGDVHQIRLANGAVLKAKTIVLATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGNKLNALVYKDLQSGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGGTSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPVTTAAPQPAEALAA

    >gi|134293343|ref|YP_001117079.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia vietnamiensis G4]
    MPIINTQIKPFKATAYHNGDFVPVTEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSETIGKIKYPMIGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|134293393|ref|YP_001117129.1| protein of unknown function DUF395, YeeE/YedE [Burkholderia vietnamiensis G4]
    MQIDTFHFTPALSLAGGVLIGLAAAWLVAFNGRIAGISGIVGGLLTARGGERAWRAAFVAGLIAAPLMMRVAGSGAMPQV
    NAGWGELLAAGLLVGIGTRYAGG
    CTSGHGVCGLSRGAVRSIVATAVFIVAGFATVFVRRHVLGG

    >gi|134293513|ref|YP_001117249.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MQSADSLSRFPVATYEDVRARLLARDELALIDVREEDPYAQGHPLWAANLPLSKLELDAWTRIPRRDTPIVVFGEAGGED
    LAPRAAAKLAQLGYTDVRVLDGGLAGWRAAGGELFIDVNVPSKAFGEWVEAERHTPSLSAEEVQALIDAQADVVIVDARR
    YDEYQTMNIPTSTSVPGAELVLRVRALAPNPATQVVVN
    CAGRTRSIIGTQSLINAGLPNPVAALRNGTIGWTLAGQTLEH
    GAARRFPDDVEPAQRDEARRAARAVAERAGVPRITLTELAALDEPSSSLYRFDVRTPEEYESGHLPGFLSTPGGQLVQET
    DHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVLEPVDPAAFTERGQPPRAVPAAPQVAEVSPATLAGWLREAGAG
    EIAIVDVTTSANYVKRHIPGAWFVVRAQLRDALRAIPSAQRYVFTCGSSLLARFAADDARALLPASAPISVLTGGTAAWI
    DAGLPLKHGDTHLASPRVDRYRRPYEGTDNASAAMQAYLDWEYGLVEQLKRDGTHHFRVI

    >gi|134293517|ref|YP_001117253.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MQPRLNFYTANPNAIKVMRNAEEFLAKCSIEKPLAELVRLRASQINGCAFCVDMHTSDARKGGETDRRLATVVTWRETPF
    FTERERAALEWTEALTLVAGSHVPDSVWEAVRPHFTDEELFDLSMLIATINSWNRFAIAFRKMPE

    >gi|134293584|ref|YP_001117320.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MSSRSAAVWHFPVAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWASMFAAAIGATMLADSLWFFMGR
    TRGRRLLNGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGIGVFLFWDLAGASLWAAFWLI
    GGAAVHDQIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSNEPPLIFDARPRAIR
    EREPYRIAGAVPVDLDSPDLLDPELLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMIHNVRALKGGLDAWEKHGYPVEPLPA
    DADASRYFVQPDHHGAALAGEYTVRATLSK

    >gi|134294096|ref|YP_001117832.1| dihydrolipoamide dehydrogenase [Burkholderia vietnamiensis G4]
    MSLIEVKVPDIGDFSGVDVIEVNIKPGDVIEKEQTLLTLESDKASMEVPSDIAGTVKEIKVKAGDKVSQGTVIALVEAST
    GAAAPAPAKAPDAPKPAAAAPAPAAAAPAPAPQAGSYGGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLG
    GV
    CLNVGCIPSKALLHTALVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGIGAFLDP
    FHMEVQGDNGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDV
    VEMMDGLMMGADRDLVKVWEKFNAKRFGNVMLKTKTVGAQAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGA
    DKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGK
    TEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEATHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTI
    HPHPTLGESVGMAAELYEGVCTDLPPPRRA

    >gi|134294116|ref|YP_001117852.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MSYVTDVPAADSASAATHFEASLRFETDCWDVHDALTSGAADFVLLDVRGPEQFAAGHVPGARNLPHRKIVAGKLGDHPA
    DTLFVVY
    CAGPHCNGATRAAIRLARLGRPVKLMIGGIAGWRDEGFALSNDAQMETGAMN

    >gi|134294153|ref|YP_001117888.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLTELVKIRASQINACANCLNMHTVEARARGETEQRINLLAAWREAPCY
    TDRERAALGWTDALTRLSEGHDARAAAYAALVDQFSQEEQVKLTLMINVINGWNRLAVGFGLWVDPAEAKAAAASLVA

    >gi|134294254|ref|YP_001117989.1| heavy metal translocating P-type ATPase [Burkholderia vietnamiensis G4]
    MRSAFRIMQMDCPTEETLIRKKLGAMQQVSALEFNLMQRMLTVDHVPGAQPAIESAIRTLGMTPEAASADTPAAPVDAPR
    AKSWWPLALAGVAAVASEAVNWAGLPVWLSAALAIAAVLACGLTTYRKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEA
    AMVMVLFTIAELIEAKSLDRARNAIQELMQLAPDTATVQDADGTWRTLDAAQIAPGAIVRVKPGERIGLDGEVVAGRSTV
    NQAPITGESLPVDKTTGDAVYAGTINESGSFDYRVTAAASNSTLARIIHAVEQAQGAKAPTQRFVDRFARVYTPIVFAIA
    LLVAVVPPLVTGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEQGRTLSWLALDKTGTIT
    HGKPVQTDFDLHAEHADAAQVRRLGASLAARSDHPVSQAIAAAARDASAAAFDEVTDFEALAGRGVRGTIGGARYWLGNH
    RLVEELERCSPALEAKLDVLERQGKSVVMLIDEARVLGIFAVADTIKETSRAAIADLHALGIRTAMLTGDNPHTAQAIAQ
    QAGIDDARGNQLPEDKLAAVEELSARGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAF
    VRLSRATHRVLVQNIGFALGVKIVFLGLTIAGLGTMWMAVFADAGASLIVVGNGLRLLSKAGVFDGARTQR

    >gi|134294472|ref|YP_001118207.1| protein-disulfide reductase [Burkholderia vietnamiensis G4]
    MFNGMALSVRALRAFAALLSFVLVLGGLSVARAADDFLDPSVAFKFSASEAPGQVDVRFKIANGYYLYRERFAFAVKSGN
    ATLGAPQFPPGHVKFDQTFQKEVETYRDDVVVHVPVKQAAGPFELTVTSQGCADEGICYPPAEHVVKIDGAALGAAAAAD
    GAAASGSWFDKVTSADFAQSLLEGHGFLTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYVVG
    MALVYTALGIAAALVGQSLGAWLQNPWVLGAFGLLLTAFAVSLISGKDLMLPARWQNGAAQVSSARQGGHFAAVAAMGAL
    SALVVGACMTAPLFAVLAFIAHTGNAFLGGAALFAMGLGLGVPLLVVGLGAGTVLPRAGAWMDGVKVFFGIVLLAAALWI
    VWPVLAGGLKMMLAALWLLIAAAALGLFTPHAGAASIWRRFGRGLGAALAIWAATLLVGLAAGSTDPVKPLAVLAARTVA
    SGAATSAAGQAAGQAAPAFAAVRSSGELDALLKASNRPVMLDFYADW
    CVSCKEMEHLTFTDSRVQARLAQLHLVRADVTA
    NNSDDQALLKRFNLFGPPGIIFFDRNGNEIGRVVGYQAADTFLRSLDRAAVPTV

    >gi|134294535|ref|YP_001118270.1| glutathione S-transferase domain-containing protein [Burkholderia vietnamiensis G4]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|134294601|ref|YP_001118336.1| glutaredoxin-like protein [Burkholderia vietnamiensis G4]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKEFSNWPTIPQLYVKGEF
    IGGSDIMMEMYQSGELQQLFAAA

    >gi|134294615|ref|YP_001118350.1| protein-disulfide isomerase-like protein [Burkholderia vietnamiensis G4]
    MKRTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGD
    LVDTKTHKNLTDARLSDLNRIDFASLPFANAIKVVKGNGARKIAVFSDPN
    CPYCKRLETTLQSIDNVTVYTFLYPVLSPD
    STAKSKAIWCASDRAKTWESWMIDHRAPSGAGTCDTTALDKNLALGHGMNVTGTPTIFLPDGRRLPGAVSAEQLNQALVS
    SK

    >gi|134294653|ref|YP_001118388.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MIQVGEALPDAQLFEYVDDAREGCTLGPNAVSVREQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDELWC
    VSVNDAFVMGAWGRDLHTAGKVRMIADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVEAPGKFEVSDAA
    SVLATLRP

    >gi|134294688|ref|YP_001118423.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Burkholderia vietnamiensis G4]
    MSKVTLGGNPIDIAGTFPAVGSQAPDFKLVGKDLADLTLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVI
    VVSGDLPFAATRFCTTEGLANVVTASTFRGGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAQLVDEIKDEPNYD
    AALAALK

    >gi|134294690|ref|YP_001118425.1| ribosomal protein L11 methyltransferase [Burkholderia vietnamiensis G4]
    MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPERTAWQHSRVVALLSPDLEPAVLLAAA
    ANEIGIADTPKFDVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALILELDPGLAFGTGSHPTTRLCMEWLE
    QTVKPGQSVLDYGCGSGILAILARKCGADPVIGIDIDPQAVESARQNSERNHADVTYGLPDACPDGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|134294694|ref|YP_001118429.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MMKRMLAVALVAAAAIGGGLAAGHWFRGGSADDGVAAATSATSDSSAAPAPSGSPVEQLWAAALTDVDGKPATLASFKGQ
    KVVVNFWASW
    CGPCVQEMPELVALSHQYKEKGIRFIGIGVDSDQNVKNFLQKMKVDYPVFVSGYAGADLARNFGNTAGAL
    PFTVVIDQTGKIRETKLGQIQPAELKKTLDTL

    >gi|134294759|ref|YP_001118494.1| iron-sulfur cluster insertion protein ErpA [Burkholderia vietnamiensis G4]
    MNAVNESAATTAEMPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMDKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|134294840|ref|YP_001118575.1| alkylhydroperoxidase [Burkholderia vietnamiensis G4]
    MLNWNEYRKELTTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|134294860|ref|YP_001118595.1| peroxidase [Burkholderia vietnamiensis G4]
    MGLRLGDIAPDFEQESSLGTIKFHEWLGNSWGILFSHPADYTPVCTTELGLTAKLKGEFDKRNVKVIALSVDGVESHKGW
    INDINETQSTVVGFPIIADADRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|134294896|ref|YP_001118631.1| DSBA oxidoreductase [Burkholderia vietnamiensis G4]
    MTPLPAPTARPMLTVEIWSDLICPWCWIGKRRFDDALAAFPHAQHVDVVLRAYRLMPGQPVEPVEAMLAGKYRMSAAQVD
    QMLRQVTDAAASVGLRYDLPGTLVGDTLDAHRVVKLGQATGHAHALTERLYRAYFCEHGALFDHAALTDFAVEAGLERAA
    VEATLRSDAYRDEVEADVARAAQIGGRGVPLFVFGGRYAVSGAQPVDVFAQALERAWHDGASVAFHGDDAAACGPDGCEL
    PPRA

    >gi|134294954|ref|YP_001118689.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MQILTPAMLAEWLRDPARPAPVVLDVREPWEISTAQIAGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPAVPRY

    >gi|134295001|ref|YP_001118736.1| thioredoxin reductase [Burkholderia vietnamiensis G4]
    MTAYRSTQTVRRALSRTPRPPFTDSHMSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLITGIAQGGQLMTTTDVENWP
    ADAKGVQGPELMARFQEHAERFNTEIVFDHIHTAKLHEKPIRLIGDAGEYTCDALIIATGASAQYLGLPSEEAFMGKGVS
    A
    CATCDGFFYRNQEVAVIGGGNTAVEEALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKEKEGVVDIKWDHVLDEVTGE
    ESGVTGLRIKNVKTGATQDLTVQGVFVAIGHKPNTDLFQGQLEMKDGYILTKSGLQGNATSTSVPGVFAAGDVQDNVYRQ
    AITSAGTGCMAALDAQRYLETLHDKK

    >gi|134295053|ref|YP_001118788.1| disulfide bond formation protein B [Burkholderia vietnamiensis G4]
    MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFAAIGIFAFLAAGMRHWRGIWVLELLIAIA
    AAGGVGTAARHLSIQLNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIAFAVMLIAAVSS
    LWRHRRKLAR

    >gi|134295161|ref|YP_001118896.1| glutaredoxin 2 [Burkholderia vietnamiensis G4]
    MFTLYGRGWCHLCDDMRDALAPLAAELGVALDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDEAAVRGAFAARR

    >gi|134295185|ref|YP_001118920.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis G4]
    MSLARPAPRRRRPSFNRFARMAAAMAVAVALAACTRDEPGWHLTNVTGHLPDLSFTLTGGDGRPVDASAFRGRVALVYFG
    YTH
    CPDVCPETMARLMEVLAKLGPRANDVRILFVSVDPARDTPQALQSYVAAFDAAHARGLTGSDGQIESLAKRYRVAYQ
    MEQRDPSGGYEVTHSSAVYIFDAHGRARLLATDGDSPDAIAADVRRIIDTAPTT

    >gi|134295219|ref|YP_001118954.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia vietnamiensis G4]
    MKRKLLVGAAAAALVAGHALVAHAQLKPGQRAPDFTTQASLGGKTYTYTLADALKRGPVVLYFYPAAFTKGCTIEAHAFA
    DAVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSL
    SPDKHVENTLAAVKAWADAHPKQ

    >gi|134295469|ref|YP_001119204.1| OsmC family protein [Burkholderia vietnamiensis G4]
    MSELSVEASIGSVDYLVHFTDGVHQWRADEPVALGGGDTAPTPVALLLSSLGACTAITLKMYAQRKGWPLAEVHVKLAHE
    AGSAGSTIVRRITLDGDLSDEQRARLLQIANACPVHKILSHPITIDTAIA

    >gi|134295584|ref|YP_001119319.1| dihydrolipoamide dehydrogenase [Burkholderia vietnamiensis G4]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGEAEVVTAKNVIIATGSKARH
    LPNIPVDNKIVSDNEGALRFDSVPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTENGVSIAYTDKDGNAQTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|134295756|ref|YP_001119491.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MTTAIAVSSRDLLAALESNQPPQIVDVRRKSAFNESGKIIIGASWYAPEDVGNWMGDLEQSRTVVVYCAHGQERSQMCAA
    TLAQLGFAASYLEGGFAQWLADGLPVTSHTPGNPS

    >gi|134295859|ref|YP_001119594.1| thioredoxin [Burkholderia vietnamiensis G4]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|134295895|ref|YP_001119630.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia vietnamiensis G4]
    MSVEVDRQVPDFTAPATGGDISLSGLKGRKLVLYFYPKDNTPGCTTEGLQFRDLYPKFTKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCTLFDVIKMKKMYGKEVRGIERSTFLIDADGVLRQAWRGIKVPGHVDDVLSAVQAL

    >gi|134295943|ref|YP_001119678.1| hypothetical protein Bcep1808_1840 [Burkholderia vietnamiensis G4]
    MSFSRSAADPADTLPDLAATLAAPGDDAFVALGDAFHTRLPAAPLPAPYVVGFSAEVAQLLGLPPSLAAHAQFAELFAGN
    PTRDWPAHALPYASVYSGHQFGVWAGQLGDGRALTIGELPGSDGRRYELQLKGGGRTPYSRMGDGRAVLRSSIREYLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETSAVVTRVSESFVRFGHFEHFFSNDRPDLLRRLADHVIERFYPACREADDPY
    LALLEAAMLRTADMVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIGDDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLELEREHDAELANQLLETMHASHADF
    TLTFRRLAQLSKHDASRDAPVRDLFIDRAAFDAWANLYRARLSEETRDDAARAAAMNRVNPKYVLRNHLAEVAIRRAKDK
    DFSEVERLAQILRRPFDEQPEHEPYAALPPDWAGSLEVS
    CSS

    >gi|134295944|ref|YP_001119679.1| methionine-R-sulfoxide reductase [Burkholderia vietnamiensis G4]
    MSHDSDDKTYPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKIDRSHGMVRVEVRCNHCGAHLGHVFEDGPRDQTGLRY
    CINSAALNFESRPENE

    >gi|134295970|ref|YP_001119705.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia vietnamiensis G4]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTETSFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|134296040|ref|YP_001119775.1| arsenate reductase and related [Burkholderia vietnamiensis G4]
    MAKPRTVVVYGIPNCDTVKKARVWLDEHGVEFEFHDFKKLGVSAPLVEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    KSGAVALMIHKPSVIKRPVLVVNGRVKSLGFAADQYAALFAA

    >gi|134296044|ref|YP_001119779.1| glutathione peroxidase [Burkholderia vietnamiensis G4]
    MSTLYSFSAETLAGEPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDRYAARGFSVLGFPCNQFGKQEPGDATQIGA
    FCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLIGRDGRIVKRYAPSTKPEEIAADIDKLL

    >gi|134296305|ref|YP_001120040.1| iron-sulfur cluster assembly protein IscA [Burkholderia vietnamiensis G4]
    MAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFESHGVKVVVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|134296317|ref|YP_001120052.1| dihydrolipoamide dehydrogenase [Burkholderia vietnamiensis G4]
    MSLIEVKVPDIGDFSGVDVIEVNIKPGDVIEKEQTLLTLESDKASMEVPSDIAGTVKEIKVKAGDKVSQGTVIALVEAST
    GAAAPAPAKAPEAPKPAAAAPAPAAAAPAPAPQVGSYGGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLG
    GV
    CLNVGCIPSKALLHTALVVEEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGIGAFVDP
    FHMEVQGDNGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDV
    VEMMDGLMMGADRDLVKVWEKFNAKRFGNVMLKTKTVGAQAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGA
    DKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGK
    TEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEATHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTI
    HPHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|134296745|ref|YP_001120480.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia vietnamiensis G4]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESVGSVAPDSPLAERAVEQIERYFERASARFDLPLAPVGSAFQQRVWDVIS
    DIPPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDGGYFQTVKRWLLAHEGVPYR

    >gi|134296751|ref|YP_001120486.1| thioredoxin [Burkholderia vietnamiensis G4]
    MDTTLATFEKDVIEASLDTPVLVDFWAPWCGPCKTLGPLLEKLEADYAGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFIGVLPEGQLREFLDRLLPAPDEAERRAAQYALAESRFDDALAHLEAALALNPGFDDARLDLIELLLANNEVD
    AARAEAERLSPQTLQADPRYQAIKTRFDALDATADLPPTDALEARIAANPGDLDARFDLAQSLIARRAYEGALEQLLEIV
    LRDRAYGDDLGRRTMISVFELTGDRPELVAAWRRKLSMALN

    >gi|134296757|ref|YP_001120492.1| peptide methionine sulfoxide reductase [Burkholderia vietnamiensis G4]
    MENQQVISGGETGKRTEIATLAGGCFWCTEAVFLDVDGVTAVQSGYAGGHTRNPGYRDVCDGDTGHAEVVNVTFDPARIG
    YREILEIFFATHDPTQLNRQGNDVGTQYRSVVFTHSDAQRDTALDVIAELEREQVFGQPIVTQVVPLDGNYWPAEDYHQN
    YYARNPEQGYCSVVIGPKLAKFRQKFAHRLKSQRGA

    >gi|134297027|ref|YP_001120762.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis G4]
    MLHSRFGRRARQGWLLACAFAAATLLAGCDNAPKFQNLDITGNTQFGTDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAQLKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGPWVHDLKLLVD

    >gi|134297046|ref|YP_001120781.1| glutaredoxin 3 [Burkholderia vietnamiensis G4]
    MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLL
    PLLQAA

    >gi|134297047|ref|YP_001120782.1| rhodanese domain-containing protein [Burkholderia vietnamiensis G4]
    MTFFTQYTNLALIAILLVSGGLLAWPVLRRGRGGLSAAEATQLINRRNAVVIDLRAAPEFAAGHLPSARQIAAGELGAKI
    AQIAKNKSTPVLLV
    CQNGQQSQKAAREVEAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|134297050|ref|YP_001120785.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia vietnamiensis G4]
    MNDDQLLRYSRHILVDEIGIDAQQRFLDAHALIVGAGGLGSPAAMYLAASGVGTITLADADTVDLTNLQRQILHATASVG
    RSKVESGRDALAQLNPEVTVHAAALRADDAWLDEHVPRASVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDAAAPCYACVFPEDQPFEEVA
    CATMGVFAPTVGIIGAMQAAEALRVIGAFGTTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCGGRH

    >gi|134297061|ref|YP_001120796.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MNTTPSAQRRTGRARYIAAAVVVAAIAVAGFFAFNGKSTVPDATFTLLSGQKVSTGGDLKGKVYLVNFWATSCATCMQEM
    PQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKDGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|134297107|ref|YP_001120842.1| DSBA oxidoreductase [Burkholderia vietnamiensis G4]
    MKKLLSTLLLSVGLVAGFAHATPAAPVSGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTLEAWVKKQGANID
    FKRVPVAFRDDFVPHSKLYYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQGQVK
    QSAELMKNYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDYLVKQVQDKKL

    >gi|134297183|ref|YP_001120918.1| NADPH-glutathione reductase [Burkholderia vietnamiensis G4]
    MDFDYDLFVIGAGSGGVRLARMSASYGARVAIAEQEQIGGTCVLRGCIPKKLLVYASHYPHELEDAQGFGWRFDAGTHDW
    PALIAAKDREINRLSDIYINLLRQSGVDMHAGRATLVDAHTVAVGERTFRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLPALPGRIAVVGGGYIAVEFAGIFNGFGSRVDLFYRGDRILRGFDDDVRQFLTDEMTKQGVAIHAHAVVESIARADDGT
    LSVQVGDATHGPYDAVLYATGRVPNVDGLGLERAGVLLDARGAIAVDAYSATSVPSIHALGDVTSRPQLTPVATRDGSLL
    ARTLFGGARVATDHEWVPSAVFSQPEVATVGFTEAHARGVYGDLDIYRTSFRALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTMRQKVAD

    >gi|134297378|ref|YP_001121113.1| thioredoxin domain-containing protein [Burkholderia vietnamiensis G4]
    MPALNLDTDADRIAERLADPDTLLVACLCAEWCGTCRDYRTAFDQLADAHPDACFAWIDIETHADQLDDLDVENFPTILI
    EDAHTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRNILNVEA

    >gi|134297389|ref|YP_001121124.1| DNA-O6-methylguanine--protein-cysteine S-methyltransferase / transcriptional regulator Ada [Burkholderia vietnamiensis G4]
    MNTPYSTEDSRWAAVTTRDAHADGTFFYAVRTTGVFCRPSCASRLPRREHVSFFADPAAARAAGFRPCKRCRPEGLPREL
    EIVDRACAVLDAHPERLTLQQLSDAVHLSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYASAATPLGMVLVAATAQGICRIAFGDEAAPLVAELKLAFARAELVEAPSRVA
    PFVAQIRAYLDGTRHTFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSDIAEALGAPRAVRAVAAACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLAAEARHAGADETEVIEEGNAV

    >gi|134296502|ref|YP_001120237.1| hypothetical protein Bcep1808_2403 [Burkholderia vietnamiensis G4]
    MTIVNLAAYHFVSLDAIEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFVDYLRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDRGHDDDGRPVVMLDTRNAFEVDVGTFDDALDYRI
    DKFSQFPEVIDANRADLEGKTVVSF
    CTGGIRCEKAAIHMKEIGIDHVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTESVTCFACRAVVTPQAQQSPDYVPGKSCPACAQAAAAA

    >gi|134294755|ref|YP_001118490.1| OsmC family protein [Burkholderia vietnamiensis G4]
    MECKVSWMGQDGMAFSAQTGSGHLVAMDGAPEGGGHNLAPRPMEMVLVGTGGCTAYDVVLILKKSRQEVTGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAD