Burkholderia thailandensis E264 uid58081

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|83716298|ref|YP_438256.1| thioredoxin, putative [Burkholderia thailandensis E264]
    MHIVCSHCFAINRLDADRLGEHPLCGTCGSPLLTGEPANLDERHFATFVGRNDLPVVVDFWANWCGPCHAMTPQFAAAAK
    LLTGSVMFAKVETDHAQRISAQYQIRSIPTVILFLNGVESSRRTGAMSSQQITQWVRSVQPR

    >gi|83717402|ref|YP_438270.1| DNA-binding response regulator [Burkholderia thailandensis E264]
    MRILLVEDDVPLGDGIRAGMRQQGFQVDWVRDGDSGPARAARAWSRRDGPRSRFAARGRHGCSATHSQTIMRMTDTTGQC
    RRVAGARENGRWRTVRRVRYRTRRTGRSLAGGAACGAAGLAVHVAGTRAHPHPLPAMHAAHGGRVGELDSARVRTLLHLG
    MMFGADFLALGIRRCRAHPRTVFNPLGRRHQLTAVNHASRLDGRALSWLARLGVGQTGRHRDRDADQARRSERIRTEHGN
    LQTICVHSTVHGKAADPLCQIKWRRVAANTIEMHAGHHVDVNCTVHHRAARVAAWRAALIGPLRSRSAMSNSLRYRERTV
    ELADQMRKLRQSQPDPMSAFGALAVAGAKDGALTKKTRGLIALGIGISCRCGD
    CIGFDRQSPPIKRKATREEVEEAAGVA
    VYMGGGPSMMYAAPTLMAVGEPAA

    >gi|83716191|ref|YP_438302.1| thioredoxin [Burkholderia thailandensis E264]
    MHSSQAYTADAPTRAEVDALAGATVIEFGANWCGICAGAQPAIRDAFSMHADVRHLKIEDGPGRPLGRSFGIKLWPTLVF
    LRDGTEVARVVRPTHAEQIETIGFAALV

    >gi|83717278|ref|YP_438497.1| hypothetical protein BTH_II0296 [Burkholderia thailandensis E264]
    MLSNNEIKRYSRHLIMPEIGMDGQRRLKAASVLCVGTGGLGSPLATYLAAAGVGRLGLVDSDVVDVSNLQRQILHHTSDV
    GRRKVISAKEKLSAQNPEIEIVVHDAMLTPDNALDICAGYDIIADGSDNFPTRYLINDACVLLDKPNVHASIFRFDGQAT
    VFHAKHGPCYRCLFAEAPLPGEVPN
    CAEGGVLGVLPGLLGVVQATEVIKLILGIGTPLIGRLLTFDALSMRTHELRLSKD
    PDCPICGARPVIRDLVREQAAQPACAMPLPETAEIGAAALQSMLSDPSIKLTLLDVRDPNEWEICRIEGAKHIPMSVLSE
    RLHEVDRDADIIVY
    CLAGKRSSMAAALLRQAGFGSVRSLSGGIRAWAACVDPAMPIY

    >gi|83717450|ref|YP_438501.1| hypothetical protein BTH_II0300 [Burkholderia thailandensis E264]
    MARSRDIAPHAQDLPQAQAVLQAGDAAPDFSLPASRAGRPLDYALKDALHKGAVVVYFYPSAFTSGCNAQAHAFARDIDQ
    FAAAGASVVGVSLDSIERLQAFSADPQYCGGRFPVASDAQGRVARAFGLAVEPAPHGKTDTRGEPNDHDRVPRTTFVIAP
    HGKVAATIAGASAVEHVEQALAWVRRLSADNTNAR

    >gi|83716964|ref|YP_438560.1| carboxymuconolactone decarboxylase [Burkholderia thailandensis E264]
    MYPQPGPEIARRRRELAPEALAAFRAFSNSVFADGALPTKTKQLIAVAVAHVTQCPYCIRGHTKEALKAGATEGEIMEAI
    WVAAEMRAGAAYAHSALALDAMKEEAQSREAQHGEHH

    >gi|83717314|ref|YP_438718.1| OsmC-like protein superfamily protein [Burkholderia thailandensis E264]
    MLAYRGRRAGRSFPLDREHAMPLIHATAEMAPDAPNYVVDLEAGKHRLQGDENEHEGGGNVGPAPYELVLSGLTACTVAT
    LRMYMQRKAWPAARLLARAELHVDREGAQYVRRTIVVDGALDDAQRTRLAEIAEKTPVTLFIKRGTRIETTLK

    >gi|83717550|ref|YP_438797.1| organic hydroperoxide resistance protein [Burkholderia thailandensis E264]
    MNILYKTAATSTGGRDGRATSHDQKLDVKLSAPRELGGAGTEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTTVT
    AEVGIGPNEEGGFALDVELRVALPGLDTTAAKALVDRAHQV
    CPYSNATRNNVAVRLVVA

    >gi|83718316|ref|YP_438810.1| rhodanese domain-containing protein [Burkholderia thailandensis E264]
    MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTALGEQTYAAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDA
    LADTLKAHGLKQNQQVVAYDAQGGMYAARLWWLLRWLGHDSVAVLDGGLQAWQSAGHAVSQDTPPKSAGDFRAGAPLATV
    VDTQAVLANLTTKSQLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTTDGRFKSGHELREAFNPLLGATPPNKV
    ILQ
    CGSGVTACHNALAMEIAGLHDPALYAGSWSEWSSDPSRPVATGANP

    >gi|83716108|ref|YP_439403.1| carboxymuconolactone decarboxylase family protein [Burkholderia thailandensis E264]
    METRLDYRKANPHALNAMLALEERIAQSGLEPTLIELVRLRASQINGCAYCVDMHTRDARKHGETDRRLATVVVWREAPF
    FTDRERAALEWTEAVTLVARDHVPDAVWEAVRPHFTDAELVDLTLAVATINSWNRFAVSFRKLPA

    >gi|83716044|ref|YP_439673.1| pyridine nucleotide-disulphide oxidoreductase, class II [Burkholderia thailandensis E264]
    MIFDVVIVGGSFAGQAAALQLARARRNVLLIDAKQPRNRFARASHGFLGQDGQAPSAMIAAAARQLAAYPTVQFDEGDAA
    AAAAAGDRFRVSLADGRQALGKRLILATGVRDILPALPGLQERWGISVLH
    CPYCHGYELDRRPMGVLASSELAVHQAMLV
    SDWGPTTLFTQRTFVPTGDQLAMLSARGVAVEQTPVAALVGAAPALEAVRLADGRTAELSGLFIAPRTVPACDLPERLGC
    LFNDAPTGPYVAVDERQQTSVPGVFAAGDVARPMANATLAAAAGVMAAAGAHHSLIYGVGERG

    >gi|83716271|ref|YP_439759.1| dedA family protein [Burkholderia thailandensis E264]
    MWHFPQAVPASLGPWAVFASVLVTQLGMPVPAVPMLIVGGTMAAMGQASYASMLVAAVAATVLADSMWFFAGRARGRRLL
    NALVRFSLSLDTTLRVARKVFEKHGAPLLVLAKFLPGLGLVSAPLLGTTAVAVWVFLFWDVAGASLWASVWLFGGAALHD
    EIVRLMQWVSASGGTLFDAFAAIFVTFLLYRWAMRMRFRRWLAKIRISPQQLDAMLKSAAPPVVFDARPRAVREKEAYRI
    AGAYPLDLDSPDPLHPDLTTRPIVVYCV
    CPNEATAKRIVSQLHRKRIRHALALKGGLDAWEKQGYPVEPLPADFDAARYV
    APPLAEPAEPAELDAGGYPMRAGLTD

    >gi|83718002|ref|YP_439815.1| copper-translocating P-type ATPase [Burkholderia thailandensis E264]
    MNAADLRTDSAAAERDGSAVVDVRGMWCPSCANAVERVLARQAGVLDASVSFAAEAAHVQWDTAVTTLPTLLEAVARLGY
    TATLEGSQRDRRAHLAREAALIRMRLIVAVVFGMWAMPAQWTVYMDLHDAIPASIRLGLAWFAGVTTLPILLFSGWPFLR
    AAWRTSRAGVPGMDALVACGATVAFVLSVWRLLHGDSEVFFDSTAMIVTLLLAGRLIEHTMRGRAADAMQALLALPAQSV
    LLEEAHGGQREVLAKRVTAGQRFRLRPGERAALDGEIESGISTLDRALLTGESTPVAVRRGDTVEAGVLNGTGSLVVRVT
    SEVGARRADAIARTLRRMLARKTAADALAERFTRRFVPAIFLIAAATGAYGVLTGAGWSAALEHAIAVLVITCPCALGLA
    TPLALMAGAGRAARAGILFQDVEAIERATGIGIVFFDKTGTLTRGEPTVVGVHPAPGVGEAELLAAAVMAERGSEHPLAR
    AIRACGQACPISNEPGECEAVPGMGVVWRGEDGARIVVGSAALLGREGIVLDESAHCDETTAYVARNGRLLGHVRVADAV
    RPESEAAVAELQARGIEVWMLTGDRPEPAYSVAEAVGIPREHVTAGVGPEEKAAIVLDARHRHRVVAFVGDGLNDGPALA
    AADYGIAVQSACASSAAASAVVLTRGDIRQVADAIAFGARISRVMRQNLGWAAAYNLIALPVAIGGLASPALAAAAMVCS
    SISVTLNACRLSLLPSPGSRSRASSAALAASASFSILDSKK

    >gi|83717246|ref|YP_439955.1| rhodanese-like domain-containing protein [Burkholderia thailandensis E264]
    MARCYRKLSIAPLSRCAGAPDTEGSFAAVAQPPTFTPRKTGMSHVTEIPAADSAAAVAHFAASLAFETDCWDVHDALASG
    APDFVLLDVRSPEHYAAAHVPGALNLPHRKIIESRLSEFARDACFVVY
    CAGPHCNGAARAALRLARLGRPVKLMLGGVTG
    WLDEGFALARGNGA

    >gi|83717689|ref|YP_440120.1| alkyl hydroperoxide reductase, subunit c [Burkholderia thailandensis E264]
    MPIINSQIKPFKATAYHNGDFVQVSDETLKGKWSVVVFYPADFTFVCPTELGDLAERYAEFQKLGVEIYAVSTDTHFTHK
    AWHDTSDTISKIKYPMIGDPTLAISRNFDVLIEEEGLALRGTFVINPQGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGADTLTPSLDLIGKI

    >gi|83718356|ref|YP_440121.1| alkyl hydroperoxide reductase subunit [Burkholderia thailandensis E264]
    MDAGRRHAHAVARPDRQDLTPHGGTAAVCAARRRVVRGPLPAPLAPRPPRPHTAGQYLLRYGIRIVMLDANLKTQLKSYL
    ERITRPVELVASLDDGDKSRELRALLDEIASLSPQVFVVERRDEAERAPSFSVGEPGEAARIRFAGIPMGHEFTSLVLAL
    LQTGGHPVKLDDATIEQIRALDGDYTFETYISLT
    CQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVDARRIMAVPTI
    FLNGETFGQGRSSVREILAKLDSGASRRAAQALAAKPVFDMLIVGGGPAGAAAAIYAARKGISTGVVAERFGGQVLDTMA
    IENFVSVTETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGSLHEIRLASGAVLKAKAVVLATGARWREIGVPGEREYR
    NRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVTVLTHARTTELA
    GDGARLNALVYEDMRTGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVFAAGDVTTVPYKQIV
    IAVGEGAKASLGAFDYLIRSDADAVQPADADAPASAEVVAA

    >gi|83718102|ref|YP_440304.1| selenophosphate synthetase [Burkholderia thailandensis E264]
    MRRSEAGHGAGTAQSRAIARRIVDNRAFCPLSDLAMTETKQTDAAPPRLTSLSHGGGCGCKIAPGVLSDLLRRNAPPALF
    PDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIA
    AVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALGVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKGRLDAQGY
    AQMIATTTKLNRPGTALAALPGVHALTDVTGFGLLGHTLEIARGAGLTARVRYGALPWLAGVEAFAADGVFTGASGRNWA
    AYGHDVRLRDGLPAVAQALLTDPQTSGGLLVACAPDALDDVLACFADDGFDHAAVIGEVIDGPARVDVS

    >gi|83716339|ref|YP_440356.1| copper-translocating P-type ATPase [Burkholderia thailandensis E264]
    MTKLFAPAAPVTTTLLVEGMHCGGCTSRVEQALARVPGVTGAAADLAAGTATVDAASAIDAARLIDALGAAGYRATVATT
    RAACWDAQARHEGPRDEDGDDTAVAPRAATITLTIGGMT
    CGGCARRVEQALANAPGVTAAKVDFATTSAEADVAHDVDPR
    TLVAAVERAGYRAQVVRGAHADAAPAPAARPLDDAGRSHAPPAVLAADESAAAPPAPAATTKTFELDIGGMT
    CASCAGRV
    EKALSQVPGVARAAVNLATEQATVEADAHVDAARLIDAVQQAGYRASPIGTASTPSCATASATAHRPASPGADERKLAEA
    RRERALVIASAVLSAPLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMDLLVALGTSAAYG
    LSIWLMLRDPGRAAHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPDRARIVEHGVERDVPLAQVRVGTIVR
    VLPGERVPVDGRIEAGVTHVDESLITGESLPVAKEPGERVTAGSINGEGALTVATTAIGAETTLARIIRLVESAQAGKAP
    IQRLVDRVSAVFVPAIVAIAFATFAGWLAAGAGAETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARRGVLIKDAQA
    LELAQRARIVAFDKTGTLTEGKPTVTAFDAIGIPRGDALALAAAVQRDSAHPLARAAVAAFDDDDDARRSPLAAARADTP
    RAVAGRGVQARVDGRLLALGSTRWRDELGIAVPDDVARRAAALEAAGNTVSWLMRADAPRAALALVAFGDTVKPHARRAI
    ERLAARGVKSALVTGDNRGSAAAVAASLGIDEVHAQVLPDDKARVVAQMKATAGDGVVAMVGDGINDAPALAAADVGIAM
    ATGTDVAMHTAGITLMRGDPALVADAIDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAAMAFSSVSVVTNA
    LLLRRWKGDAR

    >gi|83717374|ref|YP_440401.1| dedA family protein [Burkholderia thailandensis E264]
    MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPGAIGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRA
    LKTLCKLSLSRDSCVKKTERFFGRWGVRVLAVARFIPGLSLISVPMAGALGTRYRIFVGYDGLGALLWAGCGVAIGFVFA
    KQIDWLFAGANQLGRTVLVVIVALLAAYTAVRWMRRRALIRQLANARIDVDELDRLLQADPTPVVFDARSPEHRKLDPYA
    IPGAQFADERDLRDIVAHYPATQKFVIYCS
    CPNEVSAAVMARRLKQAGFADALALRGGLDAWRDAGRRLIELDPQPGGEA
    PVRAPAPKTA

    >gi|83717960|ref|YP_440488.1| dihydrolipoamide dehydrogenase [Burkholderia thailandensis E264]
    MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAGEFDKVRGFAGDSPLGIRTEA
    PAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDARVVDGKTVEVDMGDGARMRIECEHLLLAAGSEPVELPAMPF
    GGNVISSTEALSPRVLPKRLVVVGAGYIGLELGIAYRKLGVDVTVVEARERILPIYDAELTKPVAASLKRLGVRVHLGHE
    VLGLNARGDAVRVRDDRHEQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKIDDACRTSMRNVWAIGDLTGEPML
    AHRAMAQGEMVAEIVAGKKRHFVPAAIAAICFTDPEVVSAGLAPDEAERAFGECLSASFPFAANGRALTLEGADGFVRVV
    ARRDDHLIVGWQAVGVGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI

    >gi|83716250|ref|YP_440497.1| pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia thailandensis E264]
    MREFDYLLVGGGIASVTAARTLRGENAPASIAILCGEPVLPYQRPPLSQEFLMGAAQPASIALHDAAFYASQRIDVVLGA
    RAEHLDLAKRIVRASNGGAFRYRKLLIATGASAKVPALPGIGLDGVHVLHTVAQAQALKDATAHARRATVLGGGFLGVEI
    AATLRALGLQVTLIERAPDVMPTLRAPALASRFEALCKARGIDVLTSREVRRVLGAQRVEAVETSDGGTHPCDLFVAAVG
    VTPNCGWLDGSGLALGDGIEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIVARNMLGYRLPYRDVS
    IFYGSVFGLSYNLLGYPVGATETIERGSFDDASYTLLYLADDVLRAAFTIDRPAVEIAAMNDAVRLHVNVAEQKSKLSDP
    NFALDKLPVQTILILQGGGALGAFECGAIKALEQHGVRPDVISAVSIGAFNGAIVASHPKGASKALEAFWRELSISLPLP
    HGSQWHQAWLSSYVLSCGVPNFLKPQWSQLGFGADQLRAKWTSFFDASSIEKLIARYVDFDSLGMSPTRLLIGAVDVETG
    EPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKTLPTNIVE
    VMLRREEIAYMDRVRNDLRLEEYASDFRDLVDGILAHVDAPTANEIRQQPLYIRLMGNRAALDIARITLNRDGRLSFIED
    YDFSSDAIAQLQTQGYDAALAALANDRALRRRGRRAA

    >gi|83718175|ref|YP_440557.1| arsenate reductase [Burkholderia thailandensis E264]
    MITIYHNPRCSKSRETLALLETLNQTREAINVVEYLKQPLTVAQLKALHRQFGRPVRDMIRENEAPYKDLNLADPALSDA
    QLYDAVAEHPILLQRPIVVHGDKAVIGRPPEAVKSLFE

    >gi|83720827|ref|YP_440645.1| ADA regulatory protein [Burkholderia thailandensis E264]
    MKQPAYPTDDARWAALVARDADADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTDAARAAGYRPCKRCRPEGLPRE
    LEIVNRACVVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQGGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLTIDYATADTRLGVVLVAATSKGICKIAFGDAATPLVDELRTAFANAQIVESPAR
    IAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAETLGAPRSVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAARESVEPAVDDAA

    >gi|83718599|ref|YP_440685.1| hypothetical protein BTH_I0126 [Burkholderia thailandensis E264]
    MPALNLDTDEDRIAERLRNPGTLLVACLCAEWCGTCREYRAAFDRLADAHPGACFAWIDVETHADRLDDLDVENFPTLLV
    EDASSVRFFGTVLPHAAIVERMLADLTALPGAPHAPKLRNLFD

    >gi|83721441|ref|YP_440830.1| glutathione-disulfide reductase [Burkholderia thailandensis E264]
    MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLRGCIPKKLLVYASHYGHDVEDAAGFGWTFDIGLFSW
    PALIEAKDREIARLSGIYGDLLNKSGVEIHAGRATLVDAHTVDVAGRRITARHIGVATGSRPVLPPIPGIEHAITSREAL
    DLPELPRRIAIVGGGYIAVEFAGIFNGLGADVDLFYRGAQILRGFDDDVRRALHGEMTKHGIAIHTHAGIDAIERGADGA
    LTLRLAQGAYGPYDAVLYATGRVANGDGLGLEAVGVARDARGAIEVDAYSTTTVPSIHAIGDVTARPQLTPVATRDGMLL
    AANLFGGKRIAADHRYIPSAVFSQPEIATVGLTEADARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVVG
    AHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA

    >gi|83718643|ref|YP_440841.1| copper-translocating P-type ATPase [Burkholderia thailandensis E264]
    MHDAHVHHDHGRDADERHDPHRAHGAATPGETAVDPVCGMKVPIDAPRRHDHQGRTYRFCSDACLTAFRASPQRFVGMPK
    QPASESAAPPGTIYTCPMHPQIRANAPGD
    CPICGMALEPLAPGAAEVRNPELESMTKRFWVGLALSVPLVLMTMGRMALP
    FDIGAGIDALLARWPPPHWMAASWSQCAQAALATPAVLWGGWPVFVRGWKSLVTRQLNMFSLIALGVAAAYLFSVFALLF
    PDALPRAFRSGHEIPLYFEASAVIVTLVLLGQVLELRARSRTSSAIRDLLQLAPHTAVRVNPDGSEQTVPLEAVVVGDTL
    RVKPGSKVPVDGVVVEGHSSVDESMITGEPVPAEKTVGSPVTGATVNQTGTFAMRAEKIGADTLLARIVQMVAEAGRSRA
    PIQKLADQVSGWFVLAVIALAAIAFAAWAAFGPAPALANALVVAISVLIIACPCALGLATPVSIIVGVGRGAREGVLIKD
    AEALELMEKVDTVVVDKTGTLTEGRPRVQTVVALDPQRERALLGDAASLEGASEHPLAQAIVEHAMQAGAERKPVASFDS
    VPGKGVQGMIDERAVALGNAHLMADLAVDCASVETDSNRLREAGQTVMYVAIDGRLAGYIGVADPIKETTPDAVRQLKAS
    GARIVMLTGDNPVTANAVAKTLSLDGVKAGVLPEDKYRHVQTLQQQGHVVAMAGDGVNDAPALAQANVGIAMGTGTDVAM
    NSARIVLVKGDLRGIARARALSVATMKNIRQNLFFAFVYNAVGIPVAAGVLYPWFGITLSPIFASAAMAASSVSVIGNAL
    RLRAAKT

    >gi|83721349|ref|YP_440911.1| thiol:disulfide interchange protein DsbA [Burkholderia thailandensis E264]
    MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTVEAWVKKQGDKIA
    FKRVPVAFRDDFVPHSKLFYALAALGISEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGIDKKKFLDAYNSFSVQGQVK
    QSAELLKSYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL

    >gi|83718532|ref|YP_440960.1| hypothetical protein BTH_I0402 [Burkholderia thailandensis E264]
    MSPAPAPTGRRTGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEATFTLLSGQKISTAADLKGKVYLVNFWATSCATCMQE
    MPQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGA
    PQFAELDQLLQKALDTSA

    >gi|83720647|ref|YP_440972.1| HesA/MoeB/ThiF family protein [Burkholderia thailandensis E264]
    MARFLCAPRIIFETVLPPCGPTMNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIIVGAGGLGSPAAMYLAAAGVGTITLA
    DADTVDLTNLQRQILHVSASVGRKKVESGRDALAQLNPDVKVNALAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRA
    CVAHRVPLVSGAALRFDGQISTFDFRDPGSPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGTTL
    VGRLMMLDSLRMEWSTMKIARQPDCPVCGSGGTH

    >gi|83720942|ref|YP_440975.1| rhodanese-like domain-containing protein [Burkholderia thailandensis E264]
    MTFFTDYTNLALIAILVVSGGLLAWPALRRGGGGLSAAEATQLINRRNAVVVDLRPAAEYGAGHLPSARSVEFGELQAKA
    GQLSKNKATPVLLV
    CQNGQQSQKARKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK

    >gi|83720232|ref|YP_440976.1| GrxC family glutaredoxin [Burkholderia thailandensis E264]
    MVMYSTQVCPYCMQAERLLKLRGVEHVEKVLIDKEPERRAEMMERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLKPLL
    EAA

    >gi|83720830|ref|YP_440994.1| SCO1/SenC family protein [Burkholderia thailandensis E264]
    MLIAGCNRQPAFQNLDITGNSQFASDFALPDTTGKIRTLGEFKGKAVVVFFGYTHCPDVCPTTMAELSQALQQLGPDGKR
    VQVLFVTVDPERDTAAILGQYVPAFNPTFVGLRPADEAQLKKVTKDFRVYYAKVPGKTPGSYTMDHTAASYVFDPSGKLR
    LFVRDGQGPGPWVHDLKLLLD

    >gi|83719404|ref|YP_441063.1| carboxymuconolactone decarboxylase family protein [Burkholderia thailandensis E264]
    MRQIKSSPTGFLMLEGECDPLAVNAFRSRAALRGLTRKIGRNVRAGVGACGQRRCRFNAPMRLRVERDGWARANGVASFK
    VRNRRNTMALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDD
    CIGFHVQT
    LVKLGTTRAEFEDLLATAVYMGGGPSMMYAAHALKAFEEFGGE

    >gi|83720505|ref|YP_441270.1| peptide methionine sulfoxide reductase [Burkholderia thailandensis E264]
    MAGSEQGSHRKIRRVGDDFSGNRARLRRTAAPGEWPAPHFSRNAVRVAMRRGRRKARRRRDARTRHKPCAAAAGAGAARG
    PHDERNERKESDMSEATNEIATLGGG
    CFWCQEAVFLDVNGVTAVESGYAGGHTRNPGYRDVCDGETGHAEVVNVTFDPSR
    IGYREIVEIFFATHDPTQLNRQGNDVGTQYRSVIFTRSDAQRDVALDVIRALERDKLYDAPIVTQVEPLNDNYWPAEAYH
    QNYYARNPGQGYCAVVIGPKLAKFRQKFAHRLKSRGA

    >gi|83721456|ref|YP_441275.1| thioredoxin [Burkholderia thailandensis E264]
    MDTTLATFERDVIEASLAAPVLVDFWAPWCGPCKTLGPLLEKLEQAYEGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    GGQPVDQFVGVLPEGQLRAFLDRLVPTPDEAERQAAQAALAEERIDDALSHLENALALNPGYDEARLDLVELLLALNRID
    DARAEAARLSPQTTGGADARYQAIKTRFDALDATADLPPTDALEARIASDPADLDARFDLAQSLIARRAYDGALEQLLEI
    VRRDRTFGDDVGRKTMISVFELAADQPELVSAWRRKLSAALN

    >gi|83721435|ref|YP_441281.1| methylated-DNA-protein-cysteine methyltransferase [Burkholderia thailandensis E264]
    MFNAVIDAPFGKIGIRTDASVVREIVYLPESMKSVAPDTTLAMRVARQIERYFERASAHFDLPLAEVGTPFQHRVWNAIC
    AIPPGVVLTYGQIAKQIGSAPRAVGQACGANYFPLVIP
    CHRVVASGGIGGFANHDDEGYFLKVKRWLLAHEGVRF

    >gi|83718873|ref|YP_441537.1| rhodanese superfamily protein [Burkholderia thailandensis E264]
    MRDNTVFPFSSACARPPAAPVSRGLAVGPQPPHRPNLMTTVNLAAYRFVSLDSIEQWRPLITARCNALGLRGTILLAPEG
    INLFIAGSRGATDAFVDYLRHDPLFEGKFADLPFKESLSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARMLKA
    WLDRGHDDAGRPVVMLDTRNAFEVDVGTFDNALDYRIDKFSQFPGVIEANRADLEGKTVVSF
    CTGGIRCEKAAIHMKDVG
    IENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALNPQLAPTADVTCFACRAVVPADAQQSPLYVPGKSCPACHPGDQG
    RRADHRADPAHAA

    >gi|83721490|ref|YP_441550.1| carboxymuconolactone decarboxylase family protein [Burkholderia thailandensis E264]
    MLSRCPLHCVALRGAFPRQVAWRSSRLRAVEPGTAPSGSAPRAWLDPGSARRAPGPEPLRVSTIRPDRLGSARTRMVWHV
    SKTTASSERPTASTRAAPTCIACSRQPVTNARRVTSCRQAGRIGRPRLQRKSIMSHAPRLPYPKLATKPFNALLHLSETV
    WSGSLGKRLVDLVFLRVSQINGCAY
    CIDMHWRDLVKLGVDERHLNAVAGWREAPFFDARERAALQWAESVARIPHADPSD
    EAFAQLQAHFSDTEIAELGFAIATINAWNLLNVSFRNPIPETV

    >gi|83719595|ref|YP_441672.1| AhpC/TSA family protein [Burkholderia thailandensis E264]
    MGRVVCCGRTYRYEGPGMIQVGDTLPDVQIFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQHVPGY
    VAQAERLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGGAAFTHALGLTQDLSARGMGIRSRRYAMVVDDGVV
    KTLLVEAPGKFEVSDAASVLASLTR

    >gi|83721283|ref|YP_441706.1| thiol peroxidase [Burkholderia thailandensis E264]
    MSKVTLGGNPIDIAGTFPTVGSQAPDFKLVGKDLADVSLATFAGKRKVLNIVPSLDTPTCATSTRKFNEAASKLDNTVVV
    VVSADLPFAATRFCTTEGLANVVTASTFRGGRAFADAYGVNVTSGPLDGLTARAVVVIDENNKVTHTELVGEIKNEPNYD
    AALAALK

    >gi|83718644|ref|YP_441712.1| thioredoxin family protein, putative [Burkholderia thailandensis E264]
    MHSSTRRHPHQPNLEPMNSKGIFAGIVIAAAAIAGGLAAGHWVRGNAAGSTPAGAPASAPAASSAVDTLWAASYPDVDGK
    PQRLAAFKGQKLVVNFWASW
    CGPCVEEMPELVRLSREYEKKGVRFIGIGVDSEQNVKNFLKKVPVDYPIVISGYGGADLA
    RNFGNTAGALPFTVVIDETGKVRETKLGQIHPDELKRTLDTL

    >gi|83721394|ref|YP_441779.1| OsmC/Ohr family protein [Burkholderia thailandensis E264]
    MPDYNRIKQRWSSRMECKVSWMGQDGMAFAAQTGSGHLVTMDGAPEGGGHNLAPRPMEMVLVGTGGCTAYDVVLILKKSR
    QEVTGCSVTLQAERASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELSHSFEIVTA

    >gi|83718509|ref|YP_441782.1| iron-sulfur cluster insertion protein ErpA [Burkholderia thailandensis E264]
    MNAVTESAATTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLNKNGVVLLVD
    AMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|83721537|ref|YP_441934.1| anti-oxidant AhpCTSA family protein [Burkholderia thailandensis E264]
    MSLRLGDIAPDFEQDSSLGRVKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKGEFEKRNVKVIALSVDSVESHKGW
    IDDINDTQATSVGFPIIADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKQRFPKGFKAVRPYLRLTPQPNK

    >gi|83721545|ref|YP_442052.1| rhodanese-like domain-containing protein [Burkholderia thailandensis E264]
    MQILTATALAEWLRDPARPAPVVLDVREPWEIATAKIDGSVSIPMQQIPARSEELDDEAPIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|83720928|ref|YP_442104.1| thioredoxin-disulfide reductase [Burkholderia thailandensis E264]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADPNGVQGPELMQRFLAHAERFNTEI
    VFDHIHTAKLHEKPIRLVGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGRGVSA
    CATCDGFFYRGQNVAVVGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILVDRLLEKEKEGTVEIKWDHVLDEVTGDDAGVSGVRIKHVTTGATEDVAVQGLF
    IAIGHKPNTDIFKGQLEMKDGYIITNGGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDHK


    >gi|83720270|ref|YP_442152.1| disulfide bond formation protein B [Burkholderia thailandensis E264]
    MNNLTLSLHRERRLLVLLGLVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFIGAGMASGAGIAVIEALIVLS
    AAAGVGTAARHLYVQLNPGFS
    CGFDALQPVVDSLPPAHWLPGVFKVAGLCETVYPPIFGILLPGWALIAFALIVVPVAAS
    LLRHRGRLR

    >gi|83720713|ref|YP_442262.1| hypothetical protein BTH_I1727 [Burkholderia thailandensis E264]
    MIAAARFTLYGRGWCHLCDDMRDALAPVAAECSASVDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDETRVRAALA
    RRGA

    >gi|83720184|ref|YP_442396.1| pyruvate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Burkholderia thailandensis E264]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLLTLESDKASMEVPSDVAGTVKEIKVKAGDKVSQGTVIALVEASA
    GAAAPAKAAEPAKPAVPAPAAAPAAAPASAPQAGSYAGAADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTALVVEEAEALASHGISFGKPQVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPY
    HMEVQGEGGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAQAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGAE
    KAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEQTHRVIGGGIVGLNAGDLISEVCLAVEMGADAQDIGKTIH
    PHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|83719700|ref|YP_442407.1| iron-sulfur cluster assembly protein IscA [Burkholderia thailandensis E264]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDELTPEDQMFESHGVKVFVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|83720692|ref|YP_442535.1| glutathione peroxidase [Burkholderia thailandensis E264]
    MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLAVLGFPCNQFGKQEPGDASQIGA
    FCEKNYGVTFPMFAKIDVNGANAHPLYRYLTEESPGILGLKAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL

    >gi|83719389|ref|YP_442539.1| ArsC family transcription regulator [Burkholderia thailandensis E264]
    MAGAKAAAGTVVYGIPNCDTVKKARTWLESHGVEFAFHDFKKAGVSAPLVKGWLADVTLAALVNRRGTTWRALTDEQKAA
    AESEAGAIALMIDKPSVIKRPVVVVDGRVKALGFSADEYAGLFA

    >gi|83720312|ref|YP_442616.1| anti-oxidant AhpCTSA family protein [Burkholderia thailandensis E264]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEILR
    ILDGLQTDELCPCNRAIGGATL

    >gi|83719546|ref|YP_442649.1| hypothetical protein BTH_I2127 [Burkholderia thailandensis E264]
    MCRRVGWLTLATPGAAVAAAWSIASVAASFSAARLLRSGARARRFVVRDCRAPHDGPTPEALPGEFPTHRAALTCVNRRP
    VRTPTIDSWRTHRRDTGSAAQRVCRARAGVGERCAMRTCCGPLRQVAWRPTMSKTYPEQYHEFQLTLGKLANSPLGPTLD
    GFSRMHQPALAAGAIDERGKRLIAIAIAVATQCDD
    CIGYYVHEALRAGASDHEVLDAAGVAVMMGGGPAVVYACHVYEAL
    EQFSAAAAEPPVPPDAVLAGTATVDDPD

    >gi|83721190|ref|YP_442660.1| methionine-R-sulfoxide reductase [Burkholderia thailandensis E264]
    MSGDRDDKRYPYPKDDAELRRRLTPMQYEVTQHAATERPFTGEYTDTEDAGIYHCVVCGTALFESGAKYHSGCGWPSYFK
    PIDAEVIDEKMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEAKPEWK

    >gi|83719782|ref|YP_442661.1| hypothetical protein BTH_I2140 [Burkholderia thailandensis E264]
    MSFSRTEAAPAATLPDLAATLAAPRDGAFLQLGAAFLTRQPAAPLPAPYVVGFSDDAARMLGLDPALRDAPGFAGLFCGN
    PTRDWPQASLPYASVYSGHQFGVWAGQLGDGRALTIGELEHDGRRYELQLKGAGRTPYSRMGDGRAVLRSSIREYLCSEA
    MHHLGIPTTRALAVIGSDQPVVREEIETSAVVTRVAESFVRFGHFEHFFANDRPEQLRALADHVIDRFYPACRDADDPYL
    ALLAEATRRTAELVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFIDAFDAKHVCNHSDTHGRYAYRMQPRIAHWNCFC
    LAQALLPLIGLHRDAPSEDARAERAVEDAHAVLGRFAEQFGPALERAMRAKLGLELEREGDAALANQLLEIMDASRADFT
    LTFRHLARVSKHDARGDAPVRDLFVDRDAFDRWANLYRARLSEEARDDAARAAAMNRANPKYVLRNHLAETAIRRAKEKD
    FSEVERLAAVLRRPFDEQPEHDAYAALPPDWASTLEVS
    CSS

    >gi|83720651|ref|YP_442709.1| anti-oxidant AhpCTSA family protein [Burkholderia thailandensis E264]
    MSVEVDRQVPDFIAPATGGEFSLSGVKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVVGVSRDSLRSHENFK
    AKLELPFPLISDPDETLCTLFGVMKLKKMYGKEVRGIERSTFVIDGEGVLRHAWRGVKVPGHVDDVLGAVQAL

    >gi|83721362|ref|YP_442739.1| thioredoxin [Burkholderia thailandensis E264]
    MQRSRPSFRKSGASCPGDRQGPPAAGAGSPRTERGIDPMSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPI
    LDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|83720445|ref|YP_442880.1| pyridine nucleotide-disulphide oxidoreductase, class II [Burkholderia thailandensis E264]
    MRPGAAHPLFSIAVFPLSKDESFMNTERSSTHFDVVVIGGSYAGQSAAMQLARARRRVLVVDAGLRRNRFSPVSHGLIGQ
    DGRPPDEIAANGKAQLLAYPNVQWLEDTVIHAERADAGFVFRSALGQHFNASSVVLAFGVVDEIPDLEGAVERWGRSVYH
    CPYCHGYELNEGRIGVLGNGSISPLLALLMPDWGKTVLLTNGTFEPNDEQRDALAERGVAIEPERVTRIVDTASVELADG
    RRIALDGLFTMNRTHLSSPVAERLGCAIEEGPLGPYIRTDDSMETSVPGVFACGDATQRGGSVALAVGSGALAGIVAHRK
    LVIP

    >gi|83720959|ref|YP_443071.1| dihydrolipoamide dehydrogenase [Burkholderia thailandensis E264]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNAAGALKLGGTCLNVGCIPSKALLASSEEFENAQHHLADHGIS
    VDGVKMDVAKMLARKDGIVEKMTGGIEFLFKKNKITWLKGHGKFAGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARH
    LPNVPVDNKIVADNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGEVKTSANGVSIAYTDKDGNAKTLDADRLIVSVGRVPNTDNLGLEAIGLKVNERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|83719703|ref|YP_443382.1| bcpB, putative [Burkholderia thailandensis E264]
    MNRKLASGAAAALFALHAVAAYAVLKAGDAAPDFSAQASLGGKTYTYSLADALKKGPVVLYFYPAAFTTGCTIEAHAFAD
    AVDAYKQYGATVIGVSADDIGTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPAISKANRVSYVISPDGKVLYEYTSLS
    PDKHVENTLNAVKAWAASHRQR

    >gi|83719996|ref|YP_443424.1| thiol:disulfide interchange protein DsbC, putative [Burkholderia thailandensis E264]
    MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEVNLGSQIVYSDASGDYVLLGE
    LVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STVKSKSIWCASDRVKSWQAWMLEHRAPTAAGNCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAS
    VK

    >gi|83720718|ref|YP_443439.1| glutaredoxin-related protein [Burkholderia thailandensis E264]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQGIKAFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFTA

    >gi|83721108|ref|YP_443478.1| stringent starvation protein A [Burkholderia thailandensis E264]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|83719466|ref|YP_443543.1| thiol:disulfide interchange protein DsbD, putative [Burkholderia thailandensis E264]
    MFNRNPLHAQSRFRFLLAVVAMLGVLFGTSFAARAADDFLDPAVAFKFSASEAPGQVDIHFKIADGYYMYRERFAFAVKS
    GSATLGEPQLPAGHVKFDPTFQKNVETYRGDLTIRLPIKQASGPFELAVTSQGCADEGICYPPAEHVARIGGAALGAAGA
    TPVAAAAGADSSATDGGHWYERVTSADYARSLLEGHGFLTIIALYFVAGMVLSLLPCSYPMIPILSAIIVGEGAHATRAR
    AFALSLTYVIGMALVYTVLGVAAALVGQSLGAWLQNPWVLGAFALLLTVFALLLIGGIDITLPQRWQNGAARTTGPRRGG
    RFVAVATMGALSALVVGACMTAPLFAVLAFIAHTGNAFLGGAALFSMGIGLGVPLLVIGIGAGTLLPRAGAWMDGVKVFF
    GVVLLAAALWIVWPVLNAASQLGLGALWLLIAAAALGLFTPHSGSSSIWRRLGRGLGAALAIWAATLLIGLAAGSTDPLR
    PLAVLAARAAPSNGVANAGAAAHEGPVFAPVRSIAELDEIVKSSTQPVMLDFYADW
    CVSCKEMEQLTFTDARVGARLSQM
    RLVRADVTANTPDDQALLKHFGLFGPPGIIVFDSNGQERGRVVGYQSADRFLRGLERMSLPAASTAS

    >gi|83720433|ref|YP_443782.1| cadmium-translocating P-type ATPase [Burkholderia thailandensis E264]
    MTEATRAENRPRTPESHRDGAHSDDARVSARADGCCSHDHPNGDFETQANHAAQSHDRDSSGHGHAPGSHANDDHPHDHD
    HDHDHDHDHDHAGSACCAPAPVAFAPLPGARQAADGRVRSAFRIMQMD
    CPTEEALIRKKLGGMSEVAALEFNLMQRMLTV
    DHTPGAEAGIAAAIRSLGMTPEQAGAGAPGRPAASAQADAPRPWWPLAVAGVAAAASEAATWLQLPVWLAAALALAAVAT
    CGLGTYRKGWIALTNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTVAELIEARSLDRARNAIQSLMRLAPDTATVKQ
    PDGTWQPVDAAQVALGAVVRVKPGERIGLDGEIVAGRSTVNQAPITGESLPVEKAEGDAVYAGTINEAGSFEYRVTAVAS
    NTTLARIIHAVEEAQGSKAPTQRFVDSFARIYTPIVFAIALVVAIAPPLLLDGAWRDWIYRALVLLVIACPCALVISTPV
    TIVSGLAAAARRGILVKGGVYLEQGRRLAWLALDKTGTITRGKPVQTDFEMRAADVDATHVRRLAASLAARSDHPVSQAV
    AAAAAAEAGTGDAARATSTPFLDVADFEAIPGRGVRGKIGGAPYWLGNHRLVEELECCTSELETRLDELERQGKTVVMLI
    DGARVLGLFAVADTVKDTSRAAVAELHALGIKTAMLTGDNPHTAQAIAQQVGIDDARGNQLPQDKLAAVDELAAGGRAVG
    MVGDGINDAPALARAGIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRSTHRVLVQNIAFALVVKAVFVGLTVAG
    MSTMWMAVFADAGASLIVVGNGLRLLRRGQ