Burkholderia rhizoxinica HKI 454 uid60487

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312602122|ref|YP_004021967.1| Thiol-disulfide isomerase and thioredoxins [Burkholderia rhizoxinica HKI 454]
    MRLCCSECNVWRERGMEEQCPYTPDAPAREQLDVLAGVTVIEFGTNWCGYCQRAQPVIAEALGRHQAMRHLKIEDGPGRL
    LGRSFRVKLWPTLIFLRDGQERARVVRPTCAEELDNALATLR

    >gi|312602123|ref|YP_004021968.1| Thiol:disulfide interchange protein DsbC [Burkholderia rhizoxinica HKI 454]
    MHFDKRGVDFSTLPLDDTLRSVNGDGDGDGDGSRRIVVFSDPYCSYCKTLEHRLAGQPDATVYTFLYPILTPGSKTMAAR
    IWCASNRTGPWSTWMLENRAQPPVAASCDATAAVLARNLIVGHKLRVMGTPTLILSNGQRINRMPSAAELEQALAVAGEP
    SHTASTR

    >gi|312602535|ref|YP_004022380.1| Peroxiredoxin [Burkholderia rhizoxinica HKI 454]
    MSIINSRIKPFNATAYRNGQFVPVSNQTLKDKWSVIVFYPADFTFVCPTELGDLADRYAEFQQLGVEIYSVSTDTHSTHK
    AWHDTSDTIGKIAYPMIGDPTQAISRHFDVLVEEEGMALRAHSSSIRQARSSYAKSMTTASAATPVSCCARCKRPSMSLR
    IQAKSALRNGPPARKRSSRRWT

    >gi|312602536|ref|YP_004022381.1| Peroxiredoxin reductase (NAD(P)H) / NADH oxidase H2O2-forming [Burkholderia rhizoxinica HKI 454]
    MLDTTLKHQLKAYLEKVSRPIDIVASVDDSDKSRELLALLDDIASLSDHIRVNVRRDEEPRKPSFSIGEPGKPNGIRFAG
    VPLGHEFTSLVLALLQTGGHPLKLDDSLIQQIRELDGDYRFETYFSLS
    CQNCPEVVQALNLMALINPRIHHVAIDGALFQ
    DEVQARQIMAVPTIFLNGERFGQGRSGIKDILAKLDSGASARAAQALQDKPVFDVLVVGGGPAGAAAAIYAARKGIATGV
    VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVTQYDVDIMDTQRAEALIPGPIHQVRLASGAVLEAKAVILATGA
    RWREIDVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVSHVTLLEYGPRLRADAVLQRKLHSLP
    NVTVITQAQTARITGDGSKVDGLTYRDLRTGESQHIELAGVFVQIGLVPNTEWLKGTVELSTHGEIVVDAKGGTSIPGVF
    AAGDVTTVPFKQIVIAIGEGAKASLGAFDHLIRHADPVVTEPVTVQPIRGGTA

    >gi|312602568|ref|YP_004022413.1| Molybdopterin biosynthesis MoeB protein [Burkholderia rhizoxinica HKI 454]
    MRWREADMTLQQQRLAQLKAEITEIDPREAAQRLAAGAILLDIRDTDEWAQGTPVAAVRVGRSFLEQQIEGVVADPDTAL
    MIL
    CGSGVRSLFVADALKRLGYRSVASVAGGFQAWTECDLPVERPKILSATERERYARHLRIPEVGEAGQAKLLARRVAL
    VGAGGLGSPIAYYLAAAGVGTLGLIDDDRIERSNLQRQILHTDARVGQSKARSAAETLTGFNPNVALVLHEVRLDSANAE
    AILADYDLVIDGSDNIATRYVVNDACVKHGIPMIYGAIFRFEGQVSAFHPAGPNGGPCYRCLFPEPPPRDLTPS
    CAEAGV
    LGVLPGVIGTLMATEALKILLGIGEPLVGRLLTYDALSERFDELRLEASPDCRWCAPHRRDRPTLNIPALTE

    >gi|312602815|ref|YP_004022660.1| Arsenate reductase family protein [Burkholderia rhizoxinica HKI 454]
    MITIYHHPRCSKSRAAYALLIDELAGREEVRTVEYLKTPPTLDELKQLHALLGVPVRKMIRDNESAFAELGLGDTSLSED
    ALLKAVSEHPVLLQRPIVVRDSRAVIGRPPEQIATLFD

    >gi|312602820|ref|YP_004022665.1| Copper-exporting ATPase [Burkholderia rhizoxinica HKI 454]
    MGPEHAALGAVSTDGSPFDRIAGPRMGIVVVVLSCVADRRAVVSCHVVVRCRAVVSLRGVASSWDLDPPIMGRLILHPSC
    IVPDMMKASPTYTTSLDYTTSLDIEGMT
    CASCVTRVERALGKVPGVSHVTVNLATERASVTAGPNVAVPTLVAAVKKAGY
    DAHPTPETPVAAPHENAAQPLAAVIASALLTLPLLAPMINMLAGGAPSGEPISDMQAASGHGAPSVPILLQAVLATVIQF
    VLGARFYRSGYKAVRALSGNMDLLVALGTSAAYGLVSLPMGDPSPWRSPPLFRSIRRRHHAGAVRQVARNPRQATDHRRD
    PCAECAAARYGARAHRRHRT

    >gi|312602858|ref|YP_004022703.1| Peroxiredoxin [Burkholderia rhizoxinica HKI 454]
    MVVFNSRRKSAMSLINTQVKPFKATAYHNGNFVTITEENLKGKWSVVVFYPADFTFVCPTELGDLADHYAEFQKLGAEIY
    GVSTDTHFTHKAWHDTSETIAKIKYPLVGDPTATLARNFEVLIEDEGLALRGTFVIDPEGQIKLYEIHDNGIGRDAKELL
    RKVQAAQYVASHPGEVCPAKWTPGAETLKPSLDLVGKI

    >gi|312602859|ref|YP_004022704.1| Peroxiredoxin reductase (NAD(P)H)/NADH oxidase H2O2-forming [Burkholderia rhizoxinica HKI 454]
    MLDANLKTQLKSYLDNVTEAIEIDAFVDDSDKSGELRALLQDIASLSTRIAVAEHVGNDVERVPSFAIRRAGTDIAVRFA
    GIPMGHEFTSLVLALLQVGGHPVKLDPDVIERIRSLDGDYTFETYLSLS
    CQNCPEVVQALNAMSVINPRIRHVAIDGALF
    QDEVQSRQVMAVPTLYLNGEVFGQGRMGVEALLAKLDSSGAAHVAAKLNAKEVFDMLIVGGGPAGAAAAIYAARKGIRIG
    VVAERFGGQVLDTLAIENFVSVKETDGPKFAAALEQHVKCYDVDVINLQRAESLQPGDVIAVQLASGARLRARSVVLATG
    ARWREIDVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVKHVTLLEFDGQLRADEVLQRKLRSL
    GNVTVHTHAQTTEVTGDGSKVDGLTYLDRSSGERHHLALEGVFVQIGLVPNTEWLTGSGVTLSPRGEIEIDAKGQTSVPG
    VFAAGDVTTVPYKQIVIAVGEGAKAALGAFEHLIRTSAPADAAPQQPIEATT

    >gi|312794833|ref|YP_004027755.1| ADA regulatory protein / O6-methylguanine-DNA methyltransferase [Burkholderia rhizoxinica HKI 454]
    MNDRVNMPVCPADRAGSSRAVAPKSASKTYHSLVMTHDTASQSSGAPGDYASDDARWAAVRAHDPCADGYFFFAVRTTGV
    FCRPSCKSRAPRRENVRFFESADAAMAEGFRACKRCQPLRAPREVELVARACSVLAERIDERVTLAQLGDAVHTSPYHLQ
    RVFSRMMGISPRQYHANLRAERLRETLRSASSVTDAALGAGFESASPLRNAARGHLGMTPSAYRRQGAGMTIAYAIASTR
    LGPILIAATERGLCKVAFGDDEASLLHALHEEFRHAKRVCDPERLAHYVERIDAYLDGRADPTHLPFDGVATAFQRRVWD
    ALRRIPYGQTRSYTEVAAELGVPNAVRAVAAACAANPVALVIP
    CHRVVQKSGALAGYRWGLQRKAALLDAERRDGDVRAA
    TPGSETLDV

    >gi|312795030|ref|YP_004027952.1| hypothetical protein RBRH_04054 [Burkholderia rhizoxinica HKI 454]
    MRGWLHDRAPSPRKWRPDMSIRIGDEAPDFTADTTEGQIRFHEWIGDHWAILFSHPKDFTPVCTTELGYVARLKTRIRQA
    QHEGDWLVDRSGQ

    >gi|312795105|ref|YP_004028027.1| Thioredoxin peroxidase [Burkholderia rhizoxinica HKI 454]
    MSQVTLGGNPIEVAGTLPAVGQKAAPFSLVGKDLADVKLNDFAGKRKVLNIVPSLDTPTCATSTRKFNEAASKLENTVVI
    VISADLPFAATRFCTTEGIENVITASTFRNREFAGQYGVEIKTGPLAGLTARAVVVLDGDDKVLHVERVSEIKNEPHYDA
    ALAALK

    >gi|312795112|ref|YP_004028034.1| Thiol:disulfide interchange protein tlpA [Burkholderia rhizoxinica HKI 454]
    MLNGNAMNSTLYPSFPPACPAPAPARRARAAWRAVACLLCAPLPACAAQPAGTAQSAYATVPPYAAHDDAVRALFASSLP
    DPVGQLQPLAQYRGKVTVVNFWASW
    CAPCVKEMPALSGLQRRYADKGVRFVGIGVDSARNISQFLSKVTIGYPVYVAGFG
    GADLARQFGNQAGGLPFTVVIDKAGHVRYSKLGEIDVARLSMELDAL

    >gi|312795207|ref|YP_004028129.1| O6-methylguanine-DNA methyltransferase [Burkholderia rhizoxinica HKI 454]
    MFNAVIDAPFGRVGIRSDDRFVHEIVYLPGTTLLREPDNALARRAAAQIVAYFEQADTVFDLPLSLAGTAFQRRVWDGIC
    RIAPGTVWTYGQLAASIGAVPRAVGQACGSNPAPLVVP
    CHRVVAANGLGGFAHHAGKGFFHDVKCWLLRHEGIRVPQQGE
    LYA

    >gi|312795382|ref|YP_004028304.1| Thioredoxin reductase [Burkholderia rhizoxinica HKI 454]
    MAEHRADGRRGYHADRWQNIVPMGAGVITPMQKSNQANAGQPLYNVRSDITHALPRGAALRTAVLQGSTAMSERKHAKVL
    ILGSGPAGYSAAVYAARANLSPMLITGLAQGGQLMTTTDVENWPGDPNGVQGPELMQRLLEHAQRFNTEIVFDHIHTAKL
    DERPLRLIGDSGEYTCDALIIATGASAQYLGLPSEQQFMGKGVSA
    CATCDGFFYRNQDVAVIGGGNTAVEEALYLSGIAK
    KVTVIHRRDKFRAEPILIDRLLAKEQEGIVQIKWNHVLDEVLGDDSGVTGLRIKHTKTGESADLAVHGLFVAIGHKPNTD
    IFEGQLEMRNGYIVTNAGLNGNATATSIAGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESIHETTAPHVMSHEAN
    R

    >gi|312795424|ref|YP_004028346.1| Disulfide bond formation protein B [Burkholderia rhizoxinica HKI 454]
    MNDSLRVRRERRLLVLLGLACVALISGALYLQYFKHEDPCPLCIIQRYFFLLIAVFAFTGATLRGWRGIAVLETLIVVAA
    AGGMAAAIQHIEVQANPSFN
    CGFDALEPIVDALPLAKLWPGAFKVAGLCEIPYPPILGLSLPQWGLIAFGLMFVLVSRSL
    WRTRKLRASRQA

    >gi|312795538|ref|YP_004028460.1| glutaredoxin [Burkholderia rhizoxinica HKI 454]
    MMAHGSRRLPRLTLYGRAWCHLCDDMRAQLDALWPSTSGIVVDVVDIDADPVLQAQYDEAVPVLLLDGVELCRYRLDPVR
    VARALADFDAGRWPTSPA

    >gi|312795556|ref|YP_004028478.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
    MFRLPMSIPLPRSRMRIPRAPRRQSVLRHTVLAACVGLLVTLSACTRDNGQWKLTNVSGHLPDLGFSLQADNGQTVSGAS
    FAGKTTLVFFGYTH
    CPDVCPETMARLMQVVEQLGDDARDVRILFISVDPHRDTPQTLHTYVQAFDPQHVVGLSGSEKQIA
    NLARRYRVAYQAEKPDGNGSYEVTHSSAVYVFDRTGRARLLATASDSANMITNDLKHLIKQTS

    >gi|312795613|ref|YP_004028535.1| peptide methionine sulfoxide reductase msrA [Burkholderia rhizoxinica HKI 454]
    MNEVATLGGGCFWCLEAVFLDVEGVTAVESGYAGGHVDAPSYEAVCNGETGHAEVVNLTFDPAVIGYREILEIFFATHDP
    TQLNRQGNDVGTQYRSVIFTHSVEQACIATAMRDELAARRFYDAPIVTQIEPLAGNYWPAEAYHQNYFANHPAQGYCAFV
    IAPKVAKFRQRFAHRLKSRRA

    >gi|312795718|ref|YP_004028640.1| Thiosulfate sulfurtransferase [Burkholderia rhizoxinica HKI 454]
    MFRLGLVRLGRCHDRLARRFAMPQHRYTTLISVGNLATRLATPGVTTLIFDCRFDLADTSAGAAAYDAAHIPGAQYLDID
    RDLSGPKTGTNGRHPLPERDTLARRLAQRGLSRGLQVVVYDAQSGMFAARLWWLLRWLGHEEVALLDGGLQAWQAAGQPL
    DNAIPAITAGSFTPSQPLSISIDVHGVQQQMRTAACRMLDARAPDRYRGENETIDPVAGHIPGARHRFFKDNLAADGRFK
    PAHTLRDEMCAVLGDTTPERTILY
    CGSGVTACHNALAMEIAGLHGAALYAGSWSEWVADPARPVTTGAQP

    >gi|312795807|ref|YP_004028729.1| Thiol:disulfide interchange protein DsbD [Burkholderia rhizoxinica HKI 454]
    MFSSSFKRSAAASWLTWIALIIAVLWIALAFRAAWASDAFLDPQDAFQFSSVEKPGTVELHFSIADGYYLYRERFAFAVK
    SGDATLGAPQLPPGKIKFDPTFNQDVETYRGKLVVTVPISRAGGAFDLVVTSQGCADQGICYPPAEHVVHLSGPAVKAGV
    AGATATGDGSARAGPLIERFFSADDAQAVLQQDGLFAVLAFFFAGGIVLSLFPCSLPMIPILSSIIVGQGAHVTRARGFT
    LSVTYVLGMALVYALLGVAAAAIGQSLGAWLQNRWVLGVFAILIAGMGCLLLAGRDIQLPQGLQDRANALSQRQAGGRFA
    AVFIMGALSAVVVGACMTAPLAAILLFIAHTGNVGVGAASLFAMGLGNGVPLLVVGIGAGTLLPRAGRWMDAVKRIFGMM
    LLAVALWLVTPVLPGTISMSLAALWLMFTAALLRLFDRSTGTVSIGARLGKGLAAALVVWAVALLVGVAAGSSDPLRPLA
    VFAGARTGSGTAATIAVTLPTFTPVTSTAQLDQALGAARRPAMLDFYANW
    CTSCKEMEQFTFSDERVRTKLASMRLLRAD
    VTANSADDQALLRRFRLFGPPGIIFFDAQGRELARVVGYQSPELFLKSLDRLIGAPSPIAG

    >gi|312795872|ref|YP_004028794.1| Stringent starvation protein A [Burkholderia rhizoxinica HKI 454]
    MGLAAKKTGMGRSSQRWPFGFLRKVEMMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILV
    ERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVGTLENEKGKTAEKAHERARAAIRDRLTQL
    APIFVKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|312795901|ref|YP_004028823.1| glutaredoxin [Burkholderia rhizoxinica HKI 454]
    MDTQERIKQIVSDHPVVLFMKGTAQFPMCGFSGRAIQVLKACGVDSVHTVNVLEDEAVRQGIKTFSNWPTIPQLYVNGEF
    VGGSDIMMEMYQSGELQQLFTNAS

    >gi|312795913|ref|YP_004028835.1| Thiol:disulfide interchange protein DsbC [Burkholderia rhizoxinica HKI 454]
    MTFQIRTIALTSVVGTLLAAAALASYSAFADTSLNSVKAAVQSRLGSDASVKGVAKTPIAGLYEVNLGKEIVYSDAHADY
    LVLGDLVETRTRKNLTQARNDELNKVDFASLPLANAVKVVKGNGARKLAVFSDPN
    CGYCKRLETTLKGFDNITVYTFLYP
    VLSPDSDMKAKAIWCSADRAKAWQAWMLDHQSPSGAGNCDTSALQKNLALGQKLNVSGTPTIILADGRRLPGAVPAEQLD
    KALSVQH

    >gi|312796026|ref|YP_004028948.1| OsmC-like protein [Burkholderia rhizoxinica HKI 454]
    MSLLLSSLGACTSITLKMYAQRKQWPLADVDVSLDIEQNDEGTTIRSTIVLHGELDDEQRERLLQIASTCPVHQLLTHPV
    AIQSGLAVAA

    >gi|312796074|ref|YP_004028996.1| Thioredoxin [Burkholderia rhizoxinica HKI 454]
    MSEQIKHITDASFEQDVLKADKPVLLDFWAEWCGPCKMIAPLLDEVARDYGDRLQVAKIDVDQNPSTPAKFSVRGIPTLI
    LFKNGVVAQTKVGALSKAQITALIDSHI

    >gi|312796140|ref|YP_004029062.1| Thioredoxin peroxidase [Burkholderia rhizoxinica HKI 454]
    MPSIAIDHAVPDFSALATGGEFTLSALKGNKVVLYFYPKDNTPGCTTESLAFRDAYPAFKQAGAEIVGISRDSVRSHENF
    QRKLELPFVLVSDADERVCQLFDVVKMKKMYGKQVRGIERSTFLLDAQHVLRREWRGVKVPNHVDEVLAAVQAL

    >gi|312796202|ref|YP_004029124.1| Dihydrolipoamide dehydrogenase [Burkholderia rhizoxinica HKI 454]
    MAKEFDVVVIGAGPGGYIAAIRAAQLGKSVACIEKWKNPAGELKLGGTCLNVGCIPSKALLASSEAFEDASHHLDDHGIS
    VSDVKIDIAKMHARKDAIVNKMTKGIEFLFRKNKITWLKGHGKFTGKTDAGYQIDVAGDGGTESVIARNVIIATGSKARH
    LPFAKVDNRIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPSFLGAADQGLAKEAAKQFAKQGL
    KIHLGVQISEVSATDSGVTISYADKDGHAQKLEADRLIVSVGRVPNTDDLGLDAIGLTVNERGFIDVDDHCRTKLPGVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTEPEIAWVGKTEEQLKAEGRQIKTGQFPFMANGRALGI
    NRADGFVKMIADANTDELLGVHIISANASDLIAEAVVAMEFKAASEDIGRICHPHPSLSEVMREAALAVDKRALNM

    >gi|312796227|ref|YP_004029149.1| glutathione peroxidase [Burkholderia rhizoxinica HKI 454]
    MVEADHGRGPSWRCVERHYCRSARHRTVVRPADAEQPGVALHCTYYLVFVQGVQMSQLYSFSARSLQGDDISLERYRGKV
    LLIVNTASE
    CGFTPQYAGLQALYERYAARGLEILGFPCNQFGKQEPGDAQQIGAFCAKNYQVTFPMFDKIDVNGAHAHPL
    YRYLTGEAPGVLGTEAIKWNFTKFLIDREGRPVKRYAPVTKPDAIEPDIEKLL

    >gi|312796233|ref|YP_004029155.1| Arsenate reductase [Burkholderia rhizoxinica HKI 454]
    MATSKSRGNALTIYGIPNCDTVKKARDWLDAHGVAYAFHDVKKAGVNAALLRDWLAQVPLDTLVNRRGTTWRALSDEQKA
    AAGTTDGAIALMIDKPSVIKRPVLVADDGIKAVGFSADQYQTLF

    >gi|312796405|ref|YP_004029327.1| hypothetical protein RBRH_01599 [Burkholderia rhizoxinica HKI 454]
    MAFSQSGTVVHEQPAFAGAIDLNRPGAFSQLGTQFLTRQSATPLPDPYVVAVSTDLAHELGLGATALTDPAFADYFCGNL
    TQYLEHAALPFASVYSGHQFGVWAGQLGDGRALTLGETEHRGQRQEIQIKGGGRTPYSRTGDGRAVLRSSIREFLCSEAM
    HCLGIPTTRALCVIGSDTPVYRETVETAAVTTRVAPTFIRFGHFEHFYSTGQVEALRRLADHVIEREFPSCRDAQDPYLA
    LLTAVCERTAALIAHWQAVGFCHGVMNTDNMSIIGLTIDYGPFGFIDGFDANHICNHSDTSGRYAYQQQPHVGRWNLICL
    AQALVPLIGAHRGTAGDERAIADARDALQGYQAHFGPALEARFRAKLGLATAEPDDVALINRLLALMHANHADFTLTFRR
    MAGVCQHDASGDAPVRDLFVDRAAFDAWAATYRQRLKTEPADDATRRAAMNRVNPKYVLRNHLAEQAVRAANGKDFTEIA
    RLLQVLSRPFDEQPEYEAYAALPPDWAASLSVS
    CSS

    >gi|312796407|ref|YP_004029329.1| peptide methionine sulfoxide reductase msrB [Burkholderia rhizoxinica HKI 454]
    MADIPHPSRPTDPAHPATSDTAGEPLAAAAPQHTVHKSEAEWREQLAPIAYEVTRRAATERPFTGEYWDHWERGVYHCVC
    CGTPLFESSTKFDAGCGWPSYFKPIHGEVMTEKTDRSHGMLRVEVRCKVCDAHLGHVFNDGPAPTGLRY
    CINSAALQFDP
    S

    >gi|312796534|ref|YP_004029456.1| transposase [Burkholderia rhizoxinica HKI 454]
    MMSQPRLPYRELSKDAYLALASVNAALGRSTLGQKLCDLVFLRVSQINGCAFCVDMHSHDLLQQSENMQRLLSMPTWRET
    ELFDARESAALNWAERLTTLPGGHPADADFQALKAHFSDTEIADLTFAIAVINAWNRLGVGMQLPVPRRTASAG

    >gi|312796713|ref|YP_004029635.1| Iron-sulphur cluster assembly protein IscA [Burkholderia rhizoxinica HKI 454]
    MAITLTEKAAQHVQKYLTRRGKGIGLRLGVRTTGCSGLAYKLEYVDELDGGDMVFESHGIKVIVDPKSLAYIDGTELDFA
    REGLNEGFRFNNPNVKDECGCGESFRV

    >gi|312796723|ref|YP_004029645.1| Dihydrolipoamide dehydrogenase [Burkholderia rhizoxinica HKI 454]
    MSLVEVKVPDIGDSNDAIVIEVLIQAGDTIDKEQSLLTLETDKASIEVPSDYAGTVKEVKIKLGDSVSKGTVIAILEVAA
    QVGDDDGYVAARPPVAFVSAPASTLTSPTASGTRPATASPLTSGQSPASGAPAAAYRGSVDIECDMLVLGAGPGGYSAAF
    RAADLGLKTVLVERYPTLGGV
    CLNVGCIPSKALLHTAAIVDEAAALAAHGITLGKPQIDLGKLREFKSGVVRKLTTGLAG
    MAKARKVQVVSGVGAFVDPYHLEVQADGGKQIVRFKQAIIAAGSQAVKLPFLPDDARVIDSTGALELPQIPQRMLVIGGG
    IIGLEMATVYSTLGASIDVVEMLDGLMQGADRDLVKVWEKFNAKRFANVMLKTRTTAAEAKPDGIYVSFEGEHAPTGPQR
    YDLVLVAVGRSPNGKRIGAERAGVAVTERGFIDVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAQAAAGEKSYFD
    ALQIPSVAYTDPEVAWAGKTEAQLKAEGVQYGKAVFPWAASGRAIANGRDEGFTKLLFDEQTHRVIGGGIVGLNAGDLIS
    EICLAVEMGADATDIGKTIHPHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|312797065|ref|YP_004029987.1| molybdopterin biosynthesis MoeB protein [Burkholderia rhizoxinica HKI 454]
    MQNLTASDLAAWLADPSRATPVLLDVREPWEVSTARLDGIVHIPMKDIPARSEELDDDAQIVCICHHGARSANVGMFLEA
    RGFKHVYNLQGGIDAWSRQVDPSVPTY

    >gi|312797274|ref|YP_004030196.1| HesB protein family [Burkholderia rhizoxinica HKI 454]
    MKAFLENSMNALTDTAVTEMPAPLVFTDAAADKVKQLIDEEGNPELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMDKN
    GVRLLIDSMSYQYLLGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|312797277|ref|YP_004030199.1| OsmC-like protein [Burkholderia rhizoxinica HKI 454]
    MECKVSWLGKDGMAFMAETGSGHMVAMDGAPEGGGRNLAPRPMEMVLLGTGGCTAYDVVMILKKSRQDIVDCNVTLKAER
    ASQDPKVFTKIHFHFTVSGRNLNPATVERAINLSHDKYCSASIMLAKSAELTHSFEIVDA

    >gi|312797398|ref|YP_004030320.1| glutaredoxin [Burkholderia rhizoxinica HKI 454]
    MSKVEMSKVVMYSTQVCPYCQMAERLLRSRGVEHIEKVLIDRDPERRAEMMERTGRRTVPQVFIGQTHVGGYDDLSALDR
    AGGLMSLLEAV

    >gi|312797399|ref|YP_004030321.1| Rhodanese-related sulfurtransferases [Burkholderia rhizoxinica HKI 454]
    MRIPSVKFFTEPANLVLIAIALISGGLLLWPVITRRDRGLSAADATQLINRRNAVVIDLRGADEFAQGHLPQARHLPFDE
    LKSKVAQVAKNKSTPVLLV
    CQNGGHSARAQNVLKEAGYAQVFTLQGGVNAWRQSGMPVVKQGAAK

    >gi|312797404|ref|YP_004030326.1| molybdopterin biosynthesis MoeB protein [Burkholderia rhizoxinica HKI 454]
    MTNAAMNDDQLLRYSRHILLDEIGIEAQQRFLDAHVLIIGAGGLGSPTAMYLGAAGVGTLTLVDADTVDLTNLQRQILHS
    SDTIGQAKVASGRATLARLNPDVRVNAIHARADDALLQQWVRHADVVLDCSDNFATRHAVNRACVQHRVPLVSGAALRFD
    GQISTFDARDPASPCYACVFAPDQPFDEVA
    CSTMGVFSPLVGIIGAMQAAEALRVIAGIGRTLVGRLMMLDAMTMDWQTM
    RIGRQADCLVCGTPHRGADAVS

    >gi|312797416|ref|YP_004030338.1| Thiol:disulfide interchange protein tlpA [Burkholderia rhizoxinica HKI 454]
    MVSSAIAKITQQKRRFNIKLALIAQPRSEIGAASRKNDDYRRRADQAAAGTPMSRMLRISDRMSAIVVMLSGDATGVASA
    EKTPMRQPATSRPSRLWIAAALVAVALAVGAYFAFNTHKQAPVASFTLLSGQKLSTADLKGKVYLVNFWATS
    CDTCVKEM
    PQMVDTYNRFKDKGLEFVAVAMQYDPPMYVANYAQTRQLPFKVAMDDGSAAKQFGNVQLTPTTFVISRDGQILKRYVGPP
    QFAELNQLLEKALAA

    >gi|312797450|ref|YP_004030372.1| Thiol:disulfide interchange protein dsbA [Burkholderia rhizoxinica HKI 454]
    MNRRHPYPSEQVSCRFFLATLLPRSTMKKTLSAALLAVAVALGTAPFAQASPSAPVAGKDYTVLTPAQPVKAPAGKVEVT
    EFMWYG
    CPHCSEFDPYLEKWKAKQGTHIVFRRVPVAFRDQFVPHSKMLLALDVLGLSEKLAPVIFDEIHVKRNYLLTPDA
    QANFLAKQGVDKKKYLDAYNSFTVASELKRVSQMAQDYKIDGVPTVIVQGKYETGPAATNSLEGTVQVLDYLVGQVAAKK
    M

    >gi|312797604|ref|YP_004030526.1| Thiol-disulfide isomerase and thioredoxins [Burkholderia rhizoxinica HKI 454]
    MAPRPHPPGEPCRHAHAATMRCQDLFSFMPALDLDHDADVITTRLSSADTLFVACLCAEWCGSCREYRAGFDALADAHPE
    ACFVWIDIETHADRLDDFDVENFPTILIEDAHATRFFGTVLPHPQIVARMLVDLSSLPGVERAPKLRPALVDA

    >gi|312797381|ref|YP_004030303.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
    MDRFLMSARAFFHLAVARAVSGPREAARASHGGLRRAVAAVVAGTALALGGCGDKPAFKNVDITGASQLGTDFALADTNG
    HVRTLADFKGKVVVLFFGYLH
    CPDVCPTTMAELAQAMQQLGDQAKRVQVLFVTLDPQRDSAPLLAQYVAAFHPSFIGLRP
    ANETQLLKVTKSFRVYSAKVPGKDGADYTVDHTAASYVFDPAGKLRLYARDGQGPGPWVHDIKLLLD