Burkholderia phytofirmans PsJN uid58729

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187918853|ref|YP_001887884.1| methylated-DNA/protein-cysteine methyltransferase [Burkholderia phytofirmans PsJN]
    MTYAYKLMDSPVGQLKLVANGERLAAILWEHDKPNRVRLGELIEANDRPVLIETERQLNEYFAGTRHEFDLPLTFQGTDF
    QKQVWAALLTIPFGQTRSYSEIATQIGNVNAVRAVGAANGKNPISIVAP
    CHRVIGASGDLTGFAGGLANKMLLLSLEAGQ
    TSFEAEADGQTDMFALEQRATVKTQVKSEAQTKPARHAPSRGTQASLFGN

    >gi|187918861|ref|YP_001887892.1| peptide methionine sulfoxide reductase [Burkholderia phytofirmans PsJN]
    MTTQTETAILAGGCFWGMQDLLRRYPGVLSTRVGYTGGDVPNATYRNHGTHAEALEIVFDPSQISYRKILEFFFQIHDPT
    TKNRQGNDTGMSYRSAIFYLDDEQKRVAENTIADVEASDLWPGKVVTEVAPAGPFWEAEPEHQDYLERIPNGYTCHFVRP
    NWKLPERG

    >gi|187918863|ref|YP_001887894.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MTKIEKVLLTGKTHTTFSGRGGRVDLNLSAGKGAGADITFPAVEAHPTAEQLFAGAWSACYISAIGLVAQAKKVTLPSDL
    SVDIEVDLGMTGDAYLLQARFNVSVPGVAREVAEAIAHEAHQI
    CPYSKATRGNIDVVVNVA

    >gi|187918912|ref|YP_001887943.1| beta-lactamase domain protein [Burkholderia phytofirmans PsJN]
    MLIFRQLFDQQSSTYTYLLADSTTREAVLIDPVFEQVRRDAALIEELGLHLLYTIDTHVHADHVTGAWMLNRRIGSRIAI
    SAASGAEGADRYLSHGDKVEFGTRYLTVRATPGHTDGCITLVLDNETMAFTGDCLLIRGTGRTDFQRGDAHTMFRAVHGQ
    IFTLPTACLLYPAHDYRGLTVTSVGEERRFNPRLGGELCEEDFTGYMTNLHLPHPKQIDVAVPANLKCGLAASVPTQMTE
    PDWAPLTCSFAGIWEINAQWLEENLRAVEIVDVREPEEFNGPLGRIPAARLISLGELAGRTAELTKDRPIVTV
    CRAGGRS
    AQATVMLRQAGFERVANLPGGMLRWRAEGRVVENGSV

    >gi|187918913|ref|YP_001887944.1| Peroxidase [Burkholderia phytofirmans PsJN]
    MSIRLGEDAPDFTAETTEGTIHFHEWIGDHWAVLFSHPKDFTPVCTTELGYLAGLKPEFDKRNTKIIGLSVDPVSDHTEW
    VKDIAETQGHAINYPLIGDSDLKVAKLYDMIHPEASGGGPRTAVDNATVRSVFLIGPDKKVKAMLVYPMSAGRNFDEVLR
    LLDALQLNAKHTVATPVNWKPGEDVIIPTSVSNDAATQKYPQGFKTVKPYLRYVAQPK

    >gi|187919024|ref|YP_001888055.1| putative DedA-like transmembrane protein [Burkholderia phytofirmans PsJN]
    MVEFPSSAVSTWGGAVVFLNVLLTRLGVPIPAVPVLLFAGSAIAAGTLSFWPVLGAAVLGALLGDGAWFTAGRLYGRKLI
    AALGRLSPAVDAKVDKARALFERFGVPLVSISKFVPGLALITPPLMGTTAVDARIYAAWDVAGALAWAAFWLLGGAAAER
    QLHMLLEFVKARGGTVIDILLASALLYLVFRLQQRRRERRRFREAAAAQAAGGWLRLAPPPKVLDARPQAPSIEAPCRIP
    GALALDPHSPEQIDGALRAHDTVIYCI
    CPDSATAVEITQRMRYNGYTRIRALRGGLDAWQRRGFPVEPLALTDEPGTGNR
    AAASLGEARGAITLRGFAPRSTQGT

    >gi|187919210|ref|YP_001888241.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MAPLCKISGQRVITFNLTFREDFDTGGALGCGHFLQYQVLNELYAGCRPSQRAHFNRPIRTFGTDMLLIVLAYLGGALTI
    LSPCILPVLPFVFARADQPFVRSGLPLLAGMALTFALVATLAAVGGGWVTQANQYGRWVAIALLAIFGLTLLFPRFADHL
    MRPLVSAGNRLSNFAQTDGQQVRAGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGTTLLLVAYAAGAATSLAVA
    LLIGGKVFTAMKRSLGAGEWIRRGIGALMLCGVAAIALGFDTGVLARVSTVATGGLEQKLVDKLSPNAAPGKAPVAGNAA
    DASGGAMMSVNAASQSTAGADADSTAVNAAQGGAMMRTAVAAEAAPLPVEGVLPPLDGAVQWLNSPPLTTQDLRGKVVLV
    DFWTYS
    CINCLRSLPYVKAWAQKYKDQGLVVIGVHAPEFAFERNIDNVKKATHDLGVDYPVAIDNNYAIWRALNNQYWPA
    HYFVDAKGQIRYHHFGEGDYAGSEKVIQQLLTEAGHANASKVALGIANGGAQGVQAAADNADMQSPETYVGYQRAENFAS
    PGGEVADKTHTYVAPSQPGVNDWGLAGSWNVGAEHATLAASSGRIVYRFHARDLHLVLGPGKDGKPVRFRVSVDGAAPGA
    SHGTDVAADGSGTVTGQRLYQLVRQTGEVGDHTFSIEFLDPGVQAFAFTFG

    >gi|187919211|ref|YP_001888242.1| peptide methionine sulfoxide reductase [Burkholderia phytofirmans PsJN]
    MRTISTRTASLRKRFSVTRIMGLVVVALGVVAAQHVAHSAEAATKIPAPVQDEKAAATHSETAVFAGGCFWGVQGVFEHV
    RGVKQVASGYTGGAASTAQYEPVSEGDTGHAESVQITYDPTQITYGRLLQIFFSVAHNPTELDYQGPDHGTQYRSAIFPV
    NAVQRGIAQSYIAQLDSAHVFSAKVVTRVEDFKGFYPAESYHQNFLALHPDYPYIAINDLPKVSDLKRMFPDLYRNDPVL
    FATASR

    >gi|187919257|ref|YP_001888288.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia phytofirmans PsJN]
    MSDLSTSLPRVPRRFDINPKPLGAALVLIALGAVYLAQTVSGRQAALYLVGALLGMSLYHAAFGFTSAWRVFIADGRGAG
    LRAQMLMLALGVLLFFPALQAGTLFGHPVVGLVAPAGTSVLVGAFMFGIGMQLGGG
    CASGTLYTVGGGSTRMIVTLAAFV
    IGSVVATAHMPFWTALPSLKPLSLVTVFGAGWAIALNLAVFAAIAALTVLIERRRHGQLVNEPPRQPHTSPWLHGPWPLF
    VGAIALTLLNFATLALSGRPWGVTSAFALWGAKLFATLGIDVADWPYWAAHANANSLAAPVTHDVTSVMDIGIILGAMSA
    AALAGRYAPVWKVPARSLIAAVVGGLMLGYGARLAYG
    CNIGAYFSGIVSGSLHGWLWLAAAFAGNVLGTRLRPAFGLEVE
    RVRSTGC

    >gi|187919313|ref|YP_001888344.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MLSATKIKTLAVATVIAAAAASGIAAFAGSPEPGASVPALGTNAAAPDFTGISQWLNSDPLTLQQLRGKVVLVDFWTYTC
    GN
    CINTLPYVKSWNQKYKDQGLTVIGVHTPEYPFERDTDNVKTAIKRFGITYPVAQDNRYATWNAYNNQYWPAFYLLDKQ
    GRIVYTHFGEGDYAKTEAKIQALLAQQG

    >gi|187919381|ref|YP_001888412.1| putative transmembrane protein [Burkholderia phytofirmans PsJN]
    MWHFPVAIPPSLGVWAVFMSVLITQLGVPIPAAPMLILGGTMAAMGQTSYASVVCAAVAATLIADSLWFFTGRAYGRRML
    NYLVRFSLSLDTTVRLARNTYERYGAPILTVAKFLPGLGLVSAPLLGTTAINVGVFLLWDFVGATLWASVWVIGGAALHD
    EIVQLMLLVRHNGGTIFDAFAAIFVAVLLYRWVRRWQFRRWLAHTRISPDQLDEMMKSNEPPLIFDARPRSVRAKESHRI
    AGARPLDLDSPEPIDPELLKRPIVVYCV
    CPNEATAKRIVEQLHRKNIHHIRALKGGLDAWQKRGYPVEPLPADFHTAKAH
    MIEDEGEEGEYTVRARLAK

    >gi|187919383|ref|YP_001888414.1| uncharacterized peroxidase-related enzyme [Burkholderia phytofirmans PsJN]
    MAKPQPISRYPVPEPDAWPDDIRARILEVQEKAGFVPNVFLTLAHRPDEFRAFFAYHDALMLKEGGLSKGEREMIVVATS
    AINQCLY
    CVVAHGAILRIYEKAPLLADQVAVNHRKADITPRQKAMLDFAVKVCSASGTVGDADFQALREHRFSDEDIWDI
    AAITAFFGLSNRMANVISMRPNDEFYLMGRVPKAAVETPKK

    >gi|187919440|ref|YP_001888471.1| cyclic nucleotide-regulated FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phytofirmans PsJN]
    MSNESRPQGDTSAPLPPADESHIDEGALADDPAVRDHPRYQQMFPVLTDAEVDRIRRFGSLSRYVKGELLYRAGSLCPGM
    FVLLSGKVRIVGRDGLGHERIIHTYTQRGEFTSDVTQLSSKPAVVDAHVVEDVEAVLVRPDELSAMMISEADLGEKIMRA
    LILRRVLVIERGQGVILVGSSNHPQLLALQNFLRRNAFPNMTLDAQRDPEAIALLERLTPQPNDFPLVVCPNGTVLRNPD
    EGQLASCLGLIPEFDPAHVYDVAIVGAGPAGLAAAVYAASEGLSVAALDCRAPGGQAGTSARIENYLGFPTGITGQALAG
    RAFVQAQKFGAHIGIPCEVKALYCHKQPPVLELADGRRITTRTVVIASGAEYRRPVVADLPRFER
    CGVYYWATPIEARLC
    RKEPVLLLGGGNSAGQAAVFLASHAEHVHMFIRGASLARSMSHYLAERVASLPNVTLHTHIELTALEGAARLERVHYRGA
    GGIEGSMTAHHLFVFIGADPNTEWLRTCSVSLDSKGFVLTGAEFGEAGVHAMPLQTSVEGIFAIGDVRSGSTKRVASAVG
    EGAAVVGQIHGFLAGVR

    >gi|187919718|ref|YP_001888749.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MSQLKAVEYAAASPEVKAVYDDIKQTRQVDDVNNFWKYIAQHPPTLARTWDSLKDVMAPGALDPFIKELLYVAVSVTNNC
    GY
    CVASHTAAARRAGMTDEMFGELLAVVGMANETNRLAVGYRVPIDPAFE

    >gi|187919824|ref|YP_001888855.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MTTINVPTRQEVSSVNQAIFDNLERRFGVVPNLFATMAHSGSALASYMALQSAKSTISGKAREVVNLVVSQVNECEYCLA
    AHTMVGKMSGFSDEQIIEIRRGRASFDSKLDALARLARGIAQSRGHVDPAVVEAFFAASWTKENLVDTIVAIGDKTITNY
    LHSTTQIPVDFPAAPALD

    >gi|187919836|ref|YP_001888867.1| Thioredoxin domain [Burkholderia phytofirmans PsJN]
    MNRIRFVKHIVGAALLAASAAAFAGEMPFTQASFDQTVSSGRPAVVYLHASWCPTCRVQKPIVDHLSADPKLKQVTIFIA
    DYDAETKLKRELKVTQQSTFVVFKDGHEVARSTGQTQEATIRAVFEQAL

    >gi|187919839|ref|YP_001888870.1| cytochrome c biogenesis protein transmembrane region [Burkholderia phytofirmans PsJN]
    MPRFTRVGAFFVLVATLLLAPSFEARAASSNWAGDQRASVRIITATDGVAGNTLQIGVEFRYPNGWHGYWRTPGDAGIAP
    IFDWSRSRNVASASVSWPAPSRLVISGLQNSVYTGDLILPVSLKLDHPHEATRIALTLDYASCANVCVPEHAEVALTLPP
    GMDGPSSEAAAIAAAAQRVPQTPAEAGIGVVHSTLEQTSAGRRLKVDLRSEGTPFLSPDLFVEGAEAGLPAAPHVHLSNH
    GHRAALEVELPPAAAAKEPLRLTVVDGSRAAEFMTASVVPTGDDGHGIVVILGLALLGGLILNFMPCVLPVLSIKVFSVV
    KAASTGRKTARRVALATALGIVTSFGLLAAVLSILKLAGASLGWGIQFQQPWFLAGMAVVTTLFAASFFDWLPIGLPPFL
    SGGASGATNRGPLVEAFLGGMLSTLLATPCSAPLVGTVVGFALARRPLEITAVLLALGVGMALPFLTLVLAPSLATRLPR
    PGQWMIQLRKIMGLLLLTTSIWLIASLWNIAGMAVASLVSIVLIAMLAVRAAETRWGSLRTARWSGAATALLACCAIAIS
    SLPPFGTGDRSAPPTEWQAFDPNAISALVASGKTVLVDVTASW
    CLTCKVNELSVLDTAAVRTRLRQDNIVRMRADWSRYN
    PGVLAYIQRFGRFGIPLDVVYGPRMPQGQLLPEILQTSTLFHALDNATPARTAKSNSSAG

    >gi|187919841|ref|YP_001888872.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MSLQKRLDAFKATFESGLPPYNVHRSAVDTLQRATDELIESGLAERAKKVGDVAPCFILKDPDHWPIGSRKLIADGPLVL
    TFYRGVWSPY
    CNLDLQALQAALPDIVARGASLMAISPQNAVNSRRTIHENRLSFPILGDPRGELSAAYGLRVALPDYLVE
    LYLTTFGTDLSSFNDDPSWTLPMPARFVIDQDGIIAYAEVSPDFTKRPDPAELLPVLDGLVAGGRA

    >gi|187919854|ref|YP_001888885.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MGLQEQLDTFRADFARTAPSGRVVLYEARIEELRASFALGEAVRTGDKAPDFSLPDVGGNPVSLSDLLLRGSVVVTFYRG
    GW
    CPYCNIQLRAYQTILPEMGALGARLVAISPQLPDGSLSTAQTNALTFDVLSDVGDAVARRYGLVYALPEDLRDALRSN
    NKALPVINGDGSWELPLPATYVIGPDGHIALASIEVDYRKRLEPDAILAAVKSLRAV

    >gi|187919979|ref|YP_001889010.1| Thioredoxin domain [Burkholderia phytofirmans PsJN]
    MATQTAYSSKAPSRAQLDALPGATLVEFGTDWCGYCQGAQASIAQALEAHDGLRHLKIEDGPGRPLGRSFKVKLWPTLIL
    MRDGAEVARVVRPANAAAVADVLTSL

    >gi|187920030|ref|YP_001889061.1| Glutathione S-transferase domain [Burkholderia phytofirmans PsJN]
    MKLYYAETLSPRKTCALAQYLGLPIDYAFVDLRRGEHTRPDYLAINPNGKVPCLVDGEKVIWEADAIMCHLAQRAESPLW
    PRGAQQQIDVVRWFSWNSQHLLRHAGALYFEYLIKPWAGLGEPDASKVAEAQGFFRKHAAVLDQHLKGRKWLLGDDLSLA
    DFSVGISLPYAKNAAMPLEEFPEVVRWHDQLNAIDAWRDPFPARQERAAANA

    >gi|187920091|ref|YP_001889122.1| peptide methionine sulfoxide reductase [Burkholderia phytofirmans PsJN]
    MTKFEKRIDGKPARSRLAAISLSVGFGALALLLAQRMAFSSEAAVVIAPPGLDEPVSATATHEETAVFAGGCFWGVQGVF
    QHVRGVTKAVSGYSGGQRDTAQYETVSGGETGHAESVQVTFDPTQVTYGQLLQVYFSVIQDPTQLNRQGPDSGTQYRSAV
    FPLNDTQRRVAQSYIAQLDKARAFPAPIVTKAEPFKGFYPAESYHQNYLTLHPNSAYIAINDMPKVANLKRLFPNLYRDK
    PVLVEASQ

    >gi|187920092|ref|YP_001889123.1| methionine-R-sulfoxide reductase [Burkholderia phytofirmans PsJN]
    MACNRRIFFRLIGALSLAGGASVWRTARAAQPAQAPGGSAAAAYEVTHSDAEWRKLLSDAQYRVLREAGTERPFTSPLND
    EHRAGTFACAGCKLPLFSSKTKFDSGTGWPSFWQPLDHAVVTHTDKSFGMTRDEVLCRRCGGHLGHVFDDGPKPTGLRY
    C
    MNGLAMTFTPTAGA

    >gi|187920099|ref|YP_001889130.1| alkyl hydroperoxide reductase, F subunit [Burkholderia phytofirmans PsJN]
    MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVNVIERRGDAERKPSFSIGEPGKDTGIRFAG
    IPMGHEFTSLVLALLQVGGHPVKLEDAVIEQIRNLDGDYQFETYFSLS
    CQNCPEVVQALNVMALINPRIRHVAIDGALFQ
    NEVEARQIMAVPTMFMNGEVFGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINEVRLANGAVLKAKTIILATGA
    RWREINVPGEREYRNHGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLA
    NVTVVTQAQTTEITGDGKKVNGLVYKDLRSGEVKQIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEEVEVVGEAEVAVAV

    >gi|187920100|ref|YP_001889131.1| peroxiredoxin [Burkholderia phytofirmans PsJN]
    MPIINSQVKPFKAQAYHNGDFQTVTEESLKGKWSVFVFYPADFTFVCPTELGDLADRYDEFQKLGVEIYSVSTDTHFTHK
    AWHDTSDTIQKIKYPMIADPTLAISRNFDVLIEEEGLALRGTFVINPEGEIKLAEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|187920148|ref|YP_001889179.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MLNWIDYRQELFGRIGEIAKLSPDTVRGYQALSSAGQKKDLLGAKTRELIALGVAVSLRCDGCITVHTAEALKHGATREE
    IAEALGVAVAVNAGAAMVYSARTIDAAAAYAEQAAAE

    >gi|187920162|ref|YP_001889193.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MKRKASAVWQGGLQDGKGSISTDSGVLKETQYSFSTRFADGIGTNPEELIAAAHAGCFSMALSAELGKAGITPERIGTTA
    TVTLDKDGGGFAITAVHLDVAVKIPGGDKAAFDKATADAKAG
    CPVSKVLNATITMDAKLET

    >gi|187920195|ref|YP_001889226.1| DSBA oxidoreductase [Burkholderia phytofirmans PsJN]
    MQNIQVEIAYDFICPWCWIGQRNLAGALAESGVAEAVSIRYVPFELNPFMPAEGMDRRSYRTRKFGSWARSQAMDAQVAA
    AGLAAGVQFNYDRVLRTPNTRLAHRLMQFAQEHNDPRKTAALYQAIYAAYFSEGRDIGSLDTLVALAGTHALDEQAARSF
    LLSEAGETAVKEARDRADRLGVRAVPTTVIEGEMISGAQPPLVFAQALRVALQGSAA

    >gi|187920292|ref|YP_001889323.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia phytofirmans PsJN]
    MSIDVASFTPGWSLAGGMMIGAAAAVLVLFNGRIAGISGILGGLLGTPRNDAGWRLAFLAGLVGAPVLAGLLGQSIVPDI
    QAGWTETLIAGALVGIGTRYGNG
    CTSGHGVCGISRGSIRSLCATATFMASGFLTVFVTRHLLGG

    >gi|187920299|ref|YP_001889330.1| Carboxymuconolactone decarboxylase [Burkholderia phytofirmans PsJN]
    MRDRQCTPGGALFPQASRRRSIAMNIDSLERALASGAEPLKLQKLIALGIAIALREDTCIAHHVADAISAGATSSELFDA
    VNVAVAIGGGPTASYGRRLRQATRQIEAGEYLLEPAVPVAVRS

    >gi|187920565|ref|YP_001889597.1| Rhodanese domain protein [Burkholderia phytofirmans PsJN]
    MSPVSSVPPADSASALAHFSASLSFETDCADVHAALTSDDPRSVDFILLDVRGPQHFSRGHVPGAVNLMHGKIVASKLAA
    YSPDTLFVTY
    CAGPHCNGATRAAIRLAQLGRPVKVMIGGITGWLDEGFQLAMVDETLPRRDPLALD

    >gi|187920630|ref|YP_001889662.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MNANAQTQESHIVNGLNVDDLFSLIEGVKGDASKATTSWRVATTWQGQAHSHSEIKGFAIGGRDVSRRFTIDIDEPRELG
    GSNQFANPQEHLIAALNA
    CMTVGYVAQCAVRGITLESLEIETEGDIDLRGFLGLDPNVANGYESLRYTVRIKGSGTREQF
    AEIHSAVMATSPNFYNLAKAVPLKSTLLVG

    >gi|187921201|ref|YP_001890233.1| selenide, water dikinase [Burkholderia phytofirmans PsJN]
    MPATMTDTPSHASASPRLTSLSHGGGCGCKIAPGLLADLLKRSAPLPFFPDLLVGNDTADDAAVYRLNDDQAIVATTDFF
    MPIVDDPFDFGRIAATNALSDVYAMGGKPIMALAIVGMPINVLPHDVIAAVLKGGESVCAEAGIPLAGGHSIDSVEPIYG
    LVAIGVVDPKRVKRNAGAQAGDVLILGKPLGVGILSAALKKDRLDAAGYAAMIGATTKLNRPGADLSRLDGVHALTDITG
    FGLLGHTLELARGSNLTARVRYADLPWLPDVVSLAEAGIFTGASGRNWDAYGKSIVLPSSLSATARTLLTDPQTSGGLLV
    SCAPQAVDEVLALFRADGFGEACVIGEMVSGEGRVEVI

    >gi|187921296|ref|YP_001890328.1| DSBA oxidoreductase [Burkholderia phytofirmans PsJN]
    MLRIDLYTEITCPWCIVGQHRLDKVLAERFPELLVGIHHHPVLLLPDAPASGLYIPDLLRIRYGITDPKVAFARPEAEAR
    ASGLSLDLGRQRMAYPTQAAHALILAAREHGTQHRLAVAITNAYFLDAKNIGSADVLADIASGHGFEYAEARAIALDPAE
    YRRVEQEAANSAAAGVRSVPHFVFGGRIAINGGRSEDEIASSLQEATRFIASNRVEHG

    >gi|187921324|ref|YP_001890356.1| DedA family protein [Burkholderia phytofirmans PsJN]
    MFSHEFIAQYGALVVFLSVLGASLGLPVAAMPTLITVGASITIATGSQQSAASHFAATLGAAALGGVLGDLAWYEGGRRF
    SERTLRTVCLLSSSRDTCVRKTERFFGRWGVRVLIVARFVPGLSLVAVPLCGAMAVRMRYFIACDYAGVALWASVALAIG
    GAFAAQVELVFAVISHLGWRALAMVASALALYCCFRLCRYLMLSKALKTARVDAAELHGLLTAEPRPVIFDIRSPERRTL
    DPFVIPSAVFADERKFAERVRAYDANRTFVIYCS
    CPGEVSAAGTAGRFGAPESH

    >gi|187921334|ref|YP_001890366.1| uncharacterized peroxidase-related enzyme [Burkholderia phytofirmans PsJN]
    MPRITALTSEQASPVALKLLQNAKAKIGMVPNLFSTLAHAPAALAGYLQLDENLKTGALSAAQREIISLAIGQFNQCGYC
    LSAHTLMGKGAGLSPDAIAAARLGSGSAVAELAVQVAQTRGNVSDADLSAARAAGLSDEQIIEVVASVALNVLTNYVNNL
    AETVIDFPKVSV

    >gi|187921418|ref|YP_001890450.1| Rhodanese domain protein [Burkholderia phytofirmans PsJN]
    MPHTHYTTLISATNLAERLAAAPGSVFVIDCRFDLADTEAGEKAYLAGHLPGAHYLHLDRDLSGPKNGQNGRHPLPDRAR
    LVETLESRGLKQGQQVVAYDAQGGMYAARAWWLLRWLGHDAVALLDGGLQAWEAGGHPLTQDVPAQNTGDFKAGAPLSVT
    VDAQTVERNLGSKERVVVDARAADRYRGENETLDRVGGHIPGALNRFFKDNLTADGRFKPAHTLREEYHALLADTPPEHV
    VLQ
    CGSGVTACVNALAMEVAGLHGAALYPGSWSEWSSDPKRPIATGANP

    >gi|187921431|ref|YP_001890463.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MNILYKASATSTGGRDGRAVSSDNALDVKLAAPRELGGTGTAGTNPEQLFAAGYSACFLSAMKFVAGQKKQTLPTDTQVT
    AEVGIGPNDKGGFALDIDLRVSLPGLDAGAAKELVDAAHQV
    CPYSNATRNNVDVRLQIA

    >gi|187921524|ref|YP_001890556.1| heavy metal translocating P-type ATPase [Burkholderia phytofirmans PsJN]
    MTELANPQRPADAASPSARTAELDIGGMTCASCALRVEKALAKVPGVTRASVNLATERARIESDAGVDPETLANAVRKAG
    YDAMLSASTSTETPAPVAEAEHSTELAIGGMT
    CASCAMRVEKALAKVPGVVGASVNLATETATVSLDGAAAAPDALIAAV
    RKAGYEATLIVPPDASAAVDHADQTAPADRKRDQTRRELAAVLASAVLTLPLVAPMVGEWFGLHAMLSPWLQLALASIVQ
    FVFGARFYRAAYRAVRAGAGNMDLLVALGTSAAYGISVYELATHPGDMMHLYFEASAVVITLVRFGKWLEARAKRQTTDA
    IRALNALRPDRARIRVGADERDVPLAQVRVGTVVIVRPGERVPVDGAVLEGRTHIDESLITGESLPVPKQVADAVTAGSI
    NGEGAIAVTTTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEIFVPAILAIAALTLVGWLMAGAGGETAILNAVAVL
    VIACPCALGLATPAAIMAGTGVAARHGVLIKDAEALETAHRVTIVAFDKTGTLTLGQPSVTAFEPIGGIGRDEALALAAA
    VQRNSDHPLARAVLKAHEVAVRNSGDGTVADTGGAVATDTGIALASGQITPQHASAARAIAGRGVEADVDGRTLALGSTR
    WLKELGIDLPPELAARAHELEAAGNTVSWLMQRKPQAPAALALIAFGDTVKPTARVAVERLAQMGIKSVLVTGDNRGSAA
    SVAKALGIGEFHAEVLPDDKARVIRDLKIRSAGIVAMAGDGINDAPALAAADIGIAMATGTDVAMHAAGITLMRGDPALV
    ADAIDISRRTWRKIQQNLFWAFVYNLIGIPLAALGLLNPMLAGAAMAFSSVSVVTNALLLRTWRGEQGRSAR

    >gi|187921576|ref|YP_001890608.1| putative DedA protein [Burkholderia phytofirmans PsJN]
    MLHDLVEQYGPALVFVNVLAASIGLPVPAMPSLVLFGAMAAMHPGSVGTQLAPVLILSIFATLIGDSAWYFAGRMYGGNT
    LKTICRLSLSRDTCVKKTERFFGRWGVRVLAVAKFVPGLSIVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIIGALFA
    KQIDMLFALAGRLGRTAALVAAALLLAYGAYRWIRRRQAMANLASARIEVDELASLVKAGNTPVLFDIRSNEKRKLDPFV
    IPGSQFADERQLDEIVATYPRDQKLVIY
    CSCPNEISAAWMAKQLNEAGFSDVLPLRGGMEAWRDSGKPVESLPNMPPPEV
    AVDDVAPKAV

    >gi|187921639|ref|YP_001890671.1| arsenate reductase [Burkholderia phytofirmans PsJN]
    MITIYHNPRCSKSRAACELITTTYNNTNEATEIVEYLKHPLTVEQLKQLNAQLGCTVREMIRDTEAEYRDLQLSDLALTD
    TQLYEALAKHPILLQRPIVVRNGRAVIGRPPENAAALFA

    >gi|187921803|ref|YP_001890835.1| arsenate reductase [Burkholderia phytofirmans PsJN]
    MSVTIYHNPDCGTSRNTLAMIRNAGIEPEIIEYLKSPPDRDTLKNLIERAGLTVRDVLREKGTPYDELGLADLSLSDEQL
    LDAMLTHPILVNRPIVVTPLGVRLCRPSEIVLDILPAGQQRAFAKEDGEQVIDSAGRRVR

    >gi|187921828|ref|YP_001890860.1| DSBA oxidoreductase [Burkholderia phytofirmans PsJN]
    MTQALTIDFVSDIACPWCAIGLSSLQRALSRLGDAVDAQIVVHPFELNPDMGPDGETIVDYLSKKYGRTPEQIAEAQAAI
    RERGASVGFTFGPRTRVYNTFDAHRLLHWAGIEGKQLALKSALLQAYHSDGKDPSDHEVLVEAAQSVGLDAVKARDVLQN
    GTYAAEVRAEERNNEAMGIQSVPAIIFNRRYLVSGGQPVETFEQAIQQILAEAENEGSQDT

    >gi|187922060|ref|YP_001893702.1| heavy metal translocating P-type ATPase [Burkholderia phytofirmans PsJN]
    MRTAIRIMQMDCPTEEALIRKKFSRMPHVRSMEFNLMQRVLTVVHAPEALDSILAALRSLDFTPELADAGPNAASGASAA
    PRAPSKPWWPLALAGMAAAGSEAAGWLGAPVWLPAGLAILAILSCGLTTYKKGWLAIRNGNLNINALMSIAVTGALLLRQ
    WPEAAMVMVLFTIAELIEAKSLDRARNAIQGLMQLTPEQASVQQLDGSWRLVDLKAIALGAVVRVKPGERIALDGEIVAG
    RSSVDQAPITGESLPVDKAVGDAVFAGTINQTGSFDYRVTAAASNTTLARIIHAVEEAQGTKAPTQRFVDQFARVYTPIV
    FAVALAVAIVPPLLFDGSWQAWVYKALVMLVIACPCALVISTPVTIVSGLAAAARKGILIKGGAYLEQGRKLTRLALDKT
    GTLTHGKPVQTEFEILAEIDALRCRTLAASLSGRSDHPVSMAIATAAKADGLKHITVAAFEAIAGRGVRGEIDGVPYWLG
    NHRLIEELGRCSASLEARLDALESQGKTVVMLVDAERVLALFAVADTVKETSRAAIAELQRLGVSTAMLTGDNPHTAAAI
    AQQVGIDEARGNQLPEDKLNAVAQWSDDGATVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPS
    FIRLSKATHAVLVQNITLALGIKSVFLVLTVIGLGTMWMAVFADVGASLLVVANGLRLLRK

    >gi|187922098|ref|YP_001893740.1| hypothetical protein Bphyt_0066 [Burkholderia phytofirmans PsJN]
    MNDMKLGDQLNLRQIFLKIPDLALPIIDCFQHLMRGPSSLSPGERELIYSYTSGLDGCHFCAFSHRHCAIGLGIPESVFS
    VPRDRIGAADLPAETRERLAFASSLHALERDSMSLTAPVLSNHPASAREDVVRVTAFTAFMNRVIDGLGAISPDAMHVIA
    GKSLAQFGYLQVRKDVESLINATGSHPTQRLDGLPSDWPGITSPLDATMAWLNAVTAQLLRQNSGISTQLRLDIRQAVLG
    SRKYPDDVNGTQQSRTERDDALLQFAVAVGTSKARSVADDFARLRGQGWTDRDIIDAVLIAAGAACSLRVTAGMDALANL
    T

    >gi|187922314|ref|YP_001893956.1| Thioredoxin domain [Burkholderia phytofirmans PsJN]
    MPALNLDTDQDRIAERVNEPDTLFVACLCAEWCGTCREYRDAFDKLADRHPEICFAWIDIETHADRFEDLDVENFPTILI
    EDSVTTRFFGTVLPQAAIVERMLSDLTAVPGVSGAPKLRPALAVA

    >gi|187922478|ref|YP_001894120.1| DSBA oxidoreductase [Burkholderia phytofirmans PsJN]
    MKKLLSILFLSLGLVAASAQASPTAPVSGKDFTVLPTAQPTDVPAGKIEVTEFFWYGCPHCNEFNPYLEAWVKKQGPDVV
    FKRVPVAFRDDFIPHSKMYHALDALGLATQLTPKVFNEIHVNKDYLLTPEDQAKFLAKNGVDPKKYMDAYNSFSTQSALQ
    KDKKLLDDYKIDGVPTLAVQGKYETGPAATNSLPGTIQVLDYLVAQVRAKKM

    >gi|187922528|ref|YP_001894170.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MSSTPSTATRRANPLRYIIIAAVAVAIAIAGYFAFAGQQRVPDATFTLLSGQKVSTADLKGKVYLVNFWATSCDTCMKEM
    PQMVQTYNRFKGQGLEFVAVAMNYDAPMYVANYTQTRQLPFKVAMDDGSAAKQFGNVQLTPTTFLVDKDGKILKRYVGEP
    QFAELDQLLEKALKPA

    >gi|187922539|ref|YP_001894181.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia phytofirmans PsJN]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAAAGVGRLTLVDADTVDLTNLQRQILHVTASVG
    HKKVESGRDAIARINPEVVVNAVAERVDDAWLDTHVPSASVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQIST
    FDFRDEASPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIVGSMQAAEALKVIGAIGTPLLGRLMMLDSLRMEWTTMRIARQ
    PDCPVCGQTHLT

    >gi|187922542|ref|YP_001894184.1| Rhodanese domain protein [Burkholderia phytofirmans PsJN]
    MKFFTDYTNLVLIAIVLISGGLLLWPTISRRGRGGLSAAEATQLINRRNAAVIDLRPSADYAKGHLPAARHLEFAELQAK
    VAQLVKNKSNPVLLV
    CQTGQQSNKAARIVQDAGYAEVHVLEGGVDAWQKAGMPVVKQGAAK

    >gi|187922543|ref|YP_001894185.1| glutaredoxin 3 [Burkholderia phytofirmans PsJN]
    MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEMMTRTGRRTVPQVFIGETHVGGYDDLSALDRAGGLM
    PLLEATA

    >gi|187922562|ref|YP_001894204.1| electron transport protein SCO1/SenC [Burkholderia phytofirmans PsJN]
    MLNNRFARTARAAVIACALGGALLIAGCGKQPPAFQNLDITGNTQFGSDFSLPDTAGHVRTLADYKGKVVVLFFGYTHCP
    DV
    CPTTMAELSQALQQLGPEDAKRVQVLFVTVDPDRDTPALLAQYVPAFNPTFVGLRPADQAQLTKITKDFRVYYAKVPG
    KTPDSYTMDHTAASYVFDTDGKLRLFARDGQGATPWVHDIKLLLD

    >gi|187922780|ref|YP_001894422.1| Peroxidase [Burkholderia phytofirmans PsJN]
    MSLRLGDIAPDFEQQSSVGPIKFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLADEFDKRNVKTIALSVDSAESHKEW
    IKDINETQAANVGFPILADGDRKVAELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DSHSVATPGNWKQGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRMTPQPKK

    >gi|187922960|ref|YP_001894602.1| Rhodanese domain protein [Burkholderia phytofirmans PsJN]
    MQNLTAPALAEWLADTSRTAPVLLDVREPWEIQTASIAGAVSIPMREIPARSEELDDDAQIVCVCHHGARSAQVAMFLES
    RGHTNVFNLQGGIDAWSRQVDPSVPTY

    >gi|187923038|ref|YP_001894680.1| thioredoxin reductase [Burkholderia phytofirmans PsJN]
    MPATSTKHAKVLILGSGPAGYTAAVYAARANLAPVLVTGLAQGGQLMTTTDVENWPADPNGVQGPELMTRFLEHAERFNT
    EIIFDHIHTAKLDEKPIRLIGDSGEYTCDSLIISTGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYKQQHVAVIGGGNTA
    VEEALYLSGIARKVTVIHRRDKFRAEPILIDRLLAKEKEGLVEIKWDSTLDEVTGDQSGVTGLRIKNTKTGATEDIALQG
    IFVAIGHKPNTDIFAGQLEMKNGYIITKGGLNGFATATSVAGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYLETIDE
    MAGEHAMSQEAER

    >gi|187923249|ref|YP_001894891.1| rhodanese superfamily protein [Burkholderia phytofirmans PsJN]
    MSIVNLSSYHFATIEDTAAWRPFVTERCNALGLKGTILLAPEGINLFVAGTRENTDAFIHYIRHDALFEGKFVDLQFKES
    LSDKQPFTRMLVKLKREIITMKKPAIRPELGRAPFVDAPTLKHWLDRGHDDQGRPVVMLDTRNAFEVDVGTFDNALDYRI
    TKFSEFPEVIEQNRADLEGKTVVSF
    CTGGIRCEKAAIHMKEVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLEPSKTTQCFGCRAVVPPQAQESPLYVAGKTCPECHPDSKAARAA

    >gi|187923383|ref|YP_001895025.1| Heavy metal transport/detoxification protein [Burkholderia phytofirmans PsJN]
    MTIEFQVEGMSCQHCVTAVTNAIREHDSGAQVRVDLASGRVAVESAQPAETLKAAIDEAGYTVTGITSGTASGSPGAAR

    >gi|187923400|ref|YP_001895042.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MAESTVTAHIGSTNFQVLFDDGKHTWLADEPESLGGGDRGPTPVSLLLSSLGACTSITLKMYAQRKDWPLADVRVTLSLE
    TGDAGTTIDRKIVLEGDLSDEQRERLLQIANQ
    CPVHKILTHSITIRSGLAVA

    >gi|187923544|ref|YP_001895186.1| Rhodanese domain protein [Burkholderia phytofirmans PsJN]
    MSFVQAFRTRSFEDVRRALLDREEIALVDVREEDPHARSHPLFAANLPLSRLELDAPVRLPRQAVPIVVFDSGEGLAERA
    AHRLTELGYTDVALLEGGLQGWREAGGELFQDVNVPSKAFGELVESVRHTPSLAAPQVQALLDHEADAVVLDVRRFDEYQ
    TMNVPGSISVPGAELVLRARQLAPNPATRIIVN
    CAGRTRSIIGAQSLINAGVPNPVAALRNGTIGWTLAGQALAHGSSRR
    FEPITDDQLRLAAADSARAVADRARVGRTSRDEARRWAGEAVRTVYRFDVRTPEEYEAGHVPGFRSAPGGQLVQETDMFA
    PVRGARVILADNDGVRANMTASWLAQMNVEVYVVDGLMAADFGEKGAAPAVRHAPTPPDADEITPAGLVTLLQSRGTAVL
    DFTSSANYVKRHIPGAWFVIRGELEKALHKLPDAQRYVVT
    CGSSQLARFAAPDVAALTGKPVQVLSGGTAAWIEAGLPVE
    SGETRMASARIDRYRRPYEGTDNAREAMNAYLEWEYGLVAQLGRDGTHGFRVI

    >gi|187923559|ref|YP_001895201.1| Glutathione S-transferase domain [Burkholderia phytofirmans PsJN]
    MKLYYSPGACSLAVHIALREADLDFEGIKVNLQTHKLANGEDYYAISPRGYVPLLEFADGSRHTEGAALLQYVADLAPES
    NLLPRAGSPQRLEALGWLTYISTELHKTFSPWLWHQETAESTKAECRAKLATRFSELEKVLAARDYLTGQFSVADAYAFT
    VLSWARMLSIDLGAYPKLKAYLERVAARPKVRQAMVAEGLIRANAA

    >gi|187923567|ref|YP_001895209.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MKKKFISVALVAAVSVGFAMHSLTASATLKPGDAAPDFTAQASLGGKTYTYSLADELKKGPVVVYFYPAAFTKGCTIEAH
    EFAEAVDEYKKYGATVIGVSHDNIDTLTKFSVSECRSKFPVAADADSKVIGAYDAGLPMHASMANRVSYVIAPDGKIIYE
    YTSLSPEKHVENTLKAVKDWAAAHKQP

    >gi|187923634|ref|YP_001895276.1| dihydrolipoamide dehydrogenase [Burkholderia phytofirmans PsJN]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENASHHLADHGIS
    VENVSVDIAKMMARKEGIVEKMTKGIEFLFRKNKITWLKGHGKFTGKTDAGVQIEVSGEGETETVTAKNVIIATGSKARH
    LPNVPVDNKIVADNEGALSFESTPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPEFLGAADQALAKEAAKQFKKQGL
    DIHVGVKVGEVTTTDNSVTVNYTDKDGNAQKLEADRLIVSIGRVPNTDNLGLEAIGLKANERGFIDVDDHCATAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEIIDGQKPHIDYNCVPWVIYTEPEIAWVGKTEQQLKAEGREIKTGQFPMMANGRALGI
    NKAEGFVKMIADAKTDEILGVHIIAADASDLIAEAVVAMEFKAASEDIGRICHPHPSLSEVMREAALAVDKRALNM

    >gi|187923786|ref|YP_001895428.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MPIAVDQPIPDFTAPATGGEITLSKLRGKKVVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEILGVSRDSLRSHDNFK
    AKLELPFPLISDPEETLCALFNVIKMKKMYGKEVRGIERSTFLIDSEGVLRQEWRGVKVPGHVDDILEAVQAL

    >gi|187923815|ref|YP_001895457.1| thioredoxin [Burkholderia phytofirmans PsJN]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKINVDEHQSTPVKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|187923867|ref|YP_001895509.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MKTVGDKVEAFTVTAAKPGFNHHEENGISAFEDITEQSFPGKWKIIYFYPKDFSFLCPTEIVEFGKLARDFEDRDAVLMG
    GSVDNEFVKLAWRRELKDLNKLNHYAFGDVKGELIDQLGVRDQEAGVALRATFIIDPDNTIQHVSVNNLNVGRNPEEVLR
    ILDALQTDEQCACNRPIGGATL

    >gi|187923913|ref|YP_001895555.1| methionine sulfoxide reductase B [Burkholderia phytofirmans PsJN]
    MNKPDELKTDAPAVQKDDAEWRKQLSDIEYQVTRHAATERPFTGRYHDHWDRGIYDCVCCGTPLFESDTKFDAGCGWPSY
    FKPIDGEVIKEKTDRSHGMLRIEVECKNCGAHLGHVFEDGPAPTGLRY
    CINSAALQFEPK

    >gi|187923914|ref|YP_001895556.1| hypothetical protein Bphyt_1924 [Burkholderia phytofirmans PsJN]
    MSFSPSIAGLSGPLSALSDALTTLHESAFARLGSVFLTRLPAAPLSAPYLVGFSAETAALLGLEPGLENDPGFAELFSGN
    LTREWPAEALPYASVYSGHQFGVWAGQLGDGRALGLGEVEHNGQRFELQLKGAGRTPYSRMGDGRAVLRSSIREYLCSEA
    MHHLGIPTTRALCVIGSDQPVRRETVETAAVVTRVAPSFVRFGHFEHFYSNDRTDALRALADHVIERFYPHCREADDPYL
    ALLNEAVISTADLMVDWQAVGFCHGVMNTDNMSIVGLTIDYGPFGFMDGFDAGYICNHSDSQGRYAYKMQPQIAYWNLFC
    LAQGLLPLLGEKHEESVRGDKAIEDAQRVLGGFKNRFAPALERRMRAKLGLEIEREGDDGLVNRLFEVMHANRADFTLTF
    RNLARVSKHDASGDAPVRDLFLDRAAFDAWVNDYRARLSEETRDDAARAIAMNRVNPKFVLRNHLAETAIRRAKEKDFSE
    VERLAAILRRPFDEQPEHEAYAGLPPDWASSLEVS
    CSS

    >gi|187924224|ref|YP_001895866.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phytofirmans PsJN]
    MTSAADQQPPPIRTDVLIVGAGPVGLFAAFEAGVIGLSCQIVDGLDKVGGQCIELYPDKPIYDIPAIASCTARELVERLL
    AQCKPFDPPIHLEQRVESVEQNDDGRWTVRTDRGLVFDVAAILLAAGNGAFVPQKLALAEAVPLESRHVHYSVPRLADFA
    DKVVVVAGGGDSALDWALALRKVARRVTLVHRRSGFSAADSSVASMRRAVEAGEMDFIVGAIAGLNVEGDALKSITLRHI
    EGETQLAAEHLVALYGLVADLGPIAQWGLSIHAGRVDVDTSNYESSRPGIFAVGDIANYPNKQKLILSGFHEASLALRRA
    YSYAYPDKKRVHVHSSYDAKLAEKVSATG

    >gi|187924225|ref|YP_001895867.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MEQRLDFYKANPAAIKALIGVEERIGKSALEKSLTELVRLRASQINGCAYCVDMHTADARKGGETDRRLATVVVWRETPF
    FTDRERAALEWTEALTLVSQEHVPDAVWEAVRPHFSDEELVDLTLLVSAINAWNRFAISFRKLPA

    >gi|187924321|ref|YP_001895963.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MTRLRPPPLTLLDKYHGRDPQTLYSTTVTVTGGDAGHGRASGIARSDDGNLVVHLRLPQALDGPGDGTNPEQLFAAGYAA
    CFHGALSLLAARASIPIPGASVQVTVDFGRDPVDGLFILTAETRIRLPGVERGVAEELVRNTERF
    CPYTKMARQGIGNVV
    ALVQQDDAGHS

    >gi|187924325|ref|YP_001895967.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MTQRINYVQQSPELFKKFFELSNLLKDSTIEESIRDLVSIRASQLNGCGFCLDMHVKEARLHGERELRVHHLATWRESTL
    FAPRERAALAWTEVLTRLPEHGVPDELYERVRTQFSEKELSDLTFEVMAINGWNRANVAFKTVPGSSDKAFGLDKANLV

    >gi|187924381|ref|YP_001896023.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MDNNKLQPPPLSLLDRYRGQDFESLYTTTVTVSGGETGHGRASGVARSDDGNLVLDLRLPSELGGPGTGTNPEQLFAAGF
    AACFHGALNLLGSRAAMEISNTVVEVQVSFGRDPVDGGYALAIDIRVRMPGVERHRVEELVRNAERL
    CPYAKMARQGTVN
    IVTVVD

    >gi|187924387|ref|YP_001896029.1| putative DedA protein [Burkholderia phytofirmans PsJN]
    MLSNELIARYGVLVVFLNVLGSSLGLPLPVIPTLIKVGAGIALNAHGASPMLLHFATIVGAAVAGGVLGDLVWFQGGKRY
    GESTLHMVCKLSLSRETCVRKTECFFGRWGVRVLIVARFLPGLSLVAVPLCGAMAVRLRSFILYDCAGVALWASAGSTVG
    ALFASQIDGVFALISHFGWDTLLVIGIALVLYVAYRYGRRVLLANALEKARISVDELHALLANKPRPIVFDIRSAERRML
    DPFVIPGAVLVDERRLQQIVENYGANRTLVIYCS
    CPNDVSAAWMAKRLRRAGVKLALPLSGGIGAWRDAGFDVDPMAVES
    DAAISGEGEKLFAH

    >gi|187924397|ref|YP_001896039.1| alkylhydroperoxidase like protein, AhpD family [Burkholderia phytofirmans PsJN]
    MTQRINYIQQSPELFKKFLEFSNQLKDCVLEESIRDLVSLRASQINGCGFCVDMHVKEARLHGERELRLHHVAIWRESTL
    FAPRERAALAWTEALTKLAEHGVSDDIYQHVRTQFSEKELSDLTFEVMAINGWNRASIAFKAVPGSADKAFGLDKANLA

    >gi|187924446|ref|YP_001896088.1| arsenate reductase and related [Burkholderia phytofirmans PsJN]
    MARGTKTVVYGIPNCDTVKKARVWLEEHGVEFEFHDFKKHGVTEPLVQDWLKDVKLDALLNRRGTTWRALSDDMKAAADT
    QSGAIALMIHKPSVIKRPVLVVNGRVKSLGFSADEYTALFA

    >gi|187924450|ref|YP_001896092.1| Glutathione peroxidase [Burkholderia phytofirmans PsJN]
    MTSIYSFSAHTLAGEEVSLGQYEGKVLLIVNTASECGFTPQYAGLQKLYDTYAARGLTVLGFPCNQFGKQEPGDAAQIGS
    FCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGLLGLEAIKWNFTKFLIGRDGNVVKRYAPLTKPEAITEDIEKLL

    >gi|187924554|ref|YP_001896196.1| iron-sulfur cluster assembly protein IscA [Burkholderia phytofirmans PsJN]
    MAITLTEKAAQHVQKYLNRRGKGVGLRVGVRTTGCSGLAYKLEYVDELAPEDEVFECNGVKLIVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|187924566|ref|YP_001896208.1| dihydrolipoamide dehydrogenase [Burkholderia phytofirmans PsJN]
    MSLVEVKVPDIGDFKDVDVIEVNIKAGDVIENEQALMTLESDKASIEVPSDTAGTVKEVRVKAGDKVSQGTVIALVETSA
    DAAPAKDAPKAPAKEPEKAPAQAEAKPQAAQAAPAKAATPAPQAGSFSGNADIECDMLVLGSGPGGYSAAFRSADLGMKT
    VLVERYATLGGV
    CLNVGCIPSKALLHTALVIDEAEALRSHGITFGKPQIDLDKLRDFKSGVVKKLTGGLAGMAKMRKVEV
    VTGTGSFVDPHHMEVQVEGGKKVVKFKQAIIAAGSEAVKLPFIPEDPRVVDSTGALELRQIPQRMLVIGGGIIGLEMATV
    YATLGAQIDVVEMLDGLMAGADRDLVKVWEKYNSKRFANVMLKTKTTAAEAKDDGIYVSFEGEKAPAEAQRYDLVLVAVG
    RSPNGKKIGADKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVAHGEKAYFDALQIPSVAY
    TDPEVAWAGKTEDQLKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMG
    ADATDIGKTIHPHPTLGESIGMAAELYEGVCTDLPPQKKK

    >gi|187924607|ref|YP_001896249.1| mercuric reductase [Burkholderia phytofirmans PsJN]
    MPQHFDAVVIGTGQGGSPLAVRLAKSGRETAVIERAAFGGTCVNVGCTPTKSYVASARAAHVARHCAELGVQVGGAISVD
    LAAVKARKDKIIGQSRDGVEAWLRGTQNMSVFKGHARFTGPRALAISGPDGNLLDEISADEVFINTGTRAVVPPLDGLER
    IRYYTNSNLLDLTELPSHLVIVGASYIALEFAQIFRRFGSQVTVLVRGERLLTREDADFADSVQKVLAREGVEFRFNVQP
    SRVEPHPHRENEVCVGFEQNIPALEASHLLFATGREPNTDDLGLAAAGIAVDKHGTIPVDGQLRTNVPGVWAIGDVNGRG
    AFTHTSYDDYQIVAANLLDGASRSVDTRIMAYAVFVDPPLARVGASEAEVRKSGRDALIATMPMTRVGRARERGETDGFM
    KVMVDKESKRVLGAAIHGIEGDEALHTFIDIMTADAPYPTLQYAMHIHPTISELVPTLLDGLKPMK

    >gi|187924878|ref|YP_001896520.1| glutaredoxin 2 [Burkholderia phytofirmans PsJN]
    MTKAAPLTLYGRAWCHLCDDLHAALEPLLAEFGAQVEVIDVDTDPVLEARYNELVPVLVCDGVELCHYHLDEARVRAALA
    ARVAARL

    >gi|187925014|ref|YP_001896656.1| disulfide bond formation protein B [Burkholderia phytofirmans PsJN]
    MNNDTAMLRRERSLLVLLGLICVALVGGALYLQYFLHEDPCPLCIIQRYFFLLIAIFAFLGARFNNWRGVRLLEVLAALS
    ALAGIVTAVRHVYVQANPGFS
    CGFDALQPLVDSLPPAHWLPGVFKVAGLCETAYPPTLGLTLPQWSLVAFVVAFIPLVLT
    LVRNRRRIA

    >gi|187925187|ref|YP_001896829.1| methylated-DNA/protein-cysteine methyltransferase [Burkholderia phytofirmans PsJN]
    MFNAVIDAPFGKIGIRLEGEAVREIVYLPDSMQNVAPDTPLARQAAEQIERYFERASAKFELPLASVGTAFQKRVWQAIS
    DIPPGVVLTYGQLARQLGSAPRAVGQACGANYFPIVIP
    CHRVVSSSGIGGFANHAEAGFFRNIKRWLLAHEGIPYA

    >gi|187925193|ref|YP_001896835.1| thioredoxin [Burkholderia phytofirmans PsJN]
    MDTTLATFEQDVITASTLAPVLVDFWAPWCGPCKTLGPMLEKLEAEAAGKWKLVKVNVDENQELAAHFQVRSIPHVMAFA
    DGRPVDQFVGVLPEGQLREFIERLVPQGADAARLEAQAALAEGRREDAYDALQAALAYDPGFDEARMDRIEMLLEDNRLD
    EARNEVDLLSPKTTQGIDARFNAIKTRLDAVDAAADLPPTDALEAKVAADPDDLEARFDLASAFIARRKYAEALEHLLAI
    VQRDRTFRDDIGRKTMLSVFDLAAHQPELVSQWRRKLSASLF

    >gi|187925198|ref|YP_001896840.1| peptide methionine sulfoxide reductase [Burkholderia phytofirmans PsJN]
    MSQTGEVATLGGGCFWCLEAVYLGVDGVNAVESGYAGGQTQRPTYEQVCDGETGHAEVVKIDFDPAKISYREILDIFFAI
    HDPTQLNRQGNDVGTQYRSVVFTHSDAQRETALQAIREIGEQGIYDGQIVTQVLPLDGNYWPAEAYHQNYFARHPNQGYC
    SFVVAPKVAKFRQQFAHRIRAS

    >gi|187925325|ref|YP_001896967.1| iron-sulfur cluster insertion protein ErpA [Burkholderia phytofirmans PsJN]
    MNAVTDTPVTEMPAPFVFTDAAADKVKQLIEEEGNADLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVMNKSGVQLLIDS
    MSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV

    >gi|187925328|ref|YP_001896970.1| OsmC family protein [Burkholderia phytofirmans PsJN]
    MECKVTWMGQDGMAFAAETGSGHLVAMDGAPEGGGRNLAPRPMEMVLLGTGGCTAYDVVMILKKSRQEISDCSVTLKAER
    ASEDPKVFTKIHFHFTVTGKNLNPATVERAINLSHDKYCSASIMMAKTAELTHSFDIVAG

    >gi|187925396|ref|YP_001897038.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MNTRRILAGACVAIVAAGGGVLANHWLNGGVEEVAHAAQPTSSQSAVGQLWTAPVTTVDGKPQTLSVLKGHPIVVNFWAS
    W
    CGPCVEEMPALSQLQRDYAKKGIQFVGLGVDSEKNVQAFLQKVKVAYPIYIAGFGGADLARAFGNTAGGLPFTVVIDAK
    GNIRSTKLGQIDPQALKQTLDTL

    >gi|187925402|ref|YP_001897044.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MSQVTLGGNPIEVAGTFPSVGQTAPAFSLVGKDLKPVSLADFAGKRKVLNIVPSLDTPTCATSTRKFNEAAAKLTNTVVI
    VVSGDLPFAASRFCTTEGIENVVTASTFRGHEFAQAYGVDVTSGPLTGLTARAVVVIDENDKVVHAELVGEIKDEPNYDA
    ALAALK

    >gi|187925436|ref|YP_001897078.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
    MIQAGDKLPDATLFELIEDERAGCTIGPNSFDVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRALGIDEIWC
    VSVNDAFVMGAWGRDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVEAAGKFEVSDAG
    SILATLS

    >gi|187925476|ref|YP_001897118.1| putative thiol-disulfide interchange protein, DsbC [Burkholderia phytofirmans PsJN]
    MKKTFRMAAAVLAIAAVTIGCSAQADQTTDKLKATLQTRLADVSIKSVTKSPIAGLYEVNLGTQIVYSDANGDYLLLGDM
    VDAKTRKNLTEARLSETNRIDFASLPFGNAVKVVKGNGARKIAVFSDPN
    CPYCKQLETSLKSIDNVTVYTFLYPVLSPDS
    TAKSKSIWCSTDRAKAWESWMQDHQAPTAAGTCDTAAIDKNLALGHAMNVDGTPTVFLADGRRLPGAVPADRLDKEMSAV
    H

    >gi|187925496|ref|YP_001897138.1| glutaredoxin-like protein [Burkholderia phytofirmans PsJN]
    MDTQQRIKQIVDENNVVLFMKGTAQFPMCGFSGRAIQILKACGVGEIKTVNVLEDDEVRQGIKQFSNWPTIPQLYVKGEF
    VGGSDIMMEMYESGELQQLFAAA

    >gi|187925513|ref|YP_001897155.1| Glutathione S-transferase domain [Burkholderia phytofirmans PsJN]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVGTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|187925587|ref|YP_001897229.1| Protein-disulfide reductase [Burkholderia phytofirmans PsJN]
    MFKGLDRRARNALRTVFFLFGCLIFAQFGTLARAADDFLDPAVAFKFSASEKPGEVDVTYKIADGYYMYRERFAFATRNG
    TTTIGEPQLPAGHIKFDQTFNKNVETYRNELTIRIPVKQAAGPFDLAVTSQGCADAGICYPPMERVYHVSGAALQAAGSV
    ATPVADVAQPSAAAAGTSWYDRATSADYAQSLLQGGGFFAIVGLFFVAGAVLSLLPCSYPMIPILSAIIIGEGARVTRAR
    GFALSLAYVVGMALVYTALGIAAALVGQSLGAWLQNPWVLGAFGVLLTIFALTLIAGFDIALPQRWQDGVSRASSGRSGG
    KFAAVAVMGALSALVVGACMTAPLFAVLAFIAHTGDAVLGGAALFSMGLGLGVPLLILGFGAGTLLPRAGAWMDGVKVFF
    GVVLLAAALWIVWPVLGATATMLLSALWLLVASASLGLFSAPTAEASVWRRLGRGIGAAFAIWAAVLLVGLAAGSSDPLR
    PLAVLAARGGEAGVASASNKPDSAPQGDLTFAPVRSSNELDQAVKSAAQPAMLDFYADW
    CVSCKEMEKFTFSDPRVQAKL
    TQMNLLRADVTANNTADQALLKRFSLFGPPGIIFFDQRGKEVLRVVGYESADKFLRSLDRASAPGA

    >gi|187925924|ref|YP_001897566.1| transcriptional regulator, AraC family [Burkholderia phytofirmans PsJN]
    MNRKSTDTAAAASWTCDDARWEAVTHRESQADGAFFYAVKTTGVFCRPSCASRLPRRENVAFFTDAAAARAAGFRDCKRC
    QPGGLPRELEIVNRACAALDADPQERLTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGSDVTRA
    TLDAGFGSPSRMYDSASAELGMAPSAYRRKGAGLIVRYASAPTSLGHVLVAATEKGICKIGFGDDKAMLADDLRGEFANA
    DVLEDPEHMAPFIAQIDAYLRGTRQDFDLPLDIASTAFRQRVWDALRRIPYGETRSYSQIAETVGAPRAVRAVASACATN
    PVALAIP
    CHRVVAKGGALAGYRWGLPRKAALLDNEAQHAGDFSGGQAERNRRADADSDLDIKTTTKLDHAA

    >gi|187920022|ref|YP_001889053.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phytofirmans PsJN]
    MADVQTDDSAAMRPARQSRQSEIDAELALGAAAAVASNALRAGSRAPLFTLSDRAGRRVSLDELLSAGPVVLHFFRGGWC
    TFAESSLADFAAGYEDVLALGASAVAIAPPCGSAVQRASGHLRELLDVDLQVARAYGVAFELPLRLRATYERLGYTRPAA
    SEASRWLVPIPATFVLDRDGGAALVHVDVDYRKSLDIESLLRALKALQARHATGLHAMRERPGRSL