Burkholderia phymatum STM815 uid58699

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|186474804|ref|YP_001856274.1| thioredoxin domain-containing protein [Burkholderia phymatum STM815]
    MPALNLDTDSKRIAERVSDRDTLFVACLCAEWCGTCREYRAAFDALADRHPDVCFAWIDIESHADRFDDLDVENFPTILI
    EDGITTRFFGTVLPQASIVERMLVDLTAVPGIKGAPKMRPALLEA

    >gi|186474955|ref|YP_001856425.1| DSBA oxidoreductase [Burkholderia phymatum STM815]
    MKKLLSILFLSFGLVASAAHAAPAAPVAGKDYTVLSAPQPVEAPAGKIEVIEFMWYGCPHCNEFDPYLEAWIKKQGPDVV
    FKRVPVAFRDDFIPHSKLYHAVDALGLANQLTPTIFHEIHVNKNYLLTPEDQAKFLAKNGVDSKKFMDAYNSFSTQSAVQ
    RDKKLMEDFRIDGVPTLAVQGKYETGPAQTNSLPGTIQVLDYLVAQVRAKKM

    >gi|186474997|ref|YP_001856467.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MSQSNVSRRSSPIRYIAAAVVTGAIAVAGYFAFGSQQHVPDATFTLLSGQKVSTADLKGKVYLVNFWATSCDTCMKEMPQ
    MIQTYNRYKDKGLEFVAVAMSYDAPMYVTNYTETRRLPFKVAMDDGSAAKQFGNVQLTPTTFVIDRNGKVLKRYVGEPQF
    AELDQLLEKALGTT

    >gi|186475032|ref|YP_001856502.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia phymatum STM815]
    MNDDQLLRYSRHILVDELGIEAQQRFLDAHALVVGAGGLGSPAAMYLAAAGVGTLTLVDADTVDLTNLQRQILHVTKSVG
    RLKVESGRDTIAQLNPDVVVNPVPERVDDAWLDRTVPHTAVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQIST
    FDFRSDASPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIAGIGEPLVGRLMMLDSLRMEWNTMRIARQ
    PDCPVCGERHRS

    >gi|186475036|ref|YP_001856506.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MVGLPFPIYPVSFLFSGGSSVKFFTDYTNLVLIAIALISGALLLWPSISRRGRGGLSAAAATQLINRRNAVVIDLRPAAE
    YAAGHLPSARQVEFGELQAKVGQLVKNKSNPVLLV
    CQNGQQSNKAARIVRDAGYAEVHVLEGGVNAWQQAGMPVVKQGVA
    K

    >gi|186475037|ref|YP_001856507.1| glutaredoxin 3 [Burkholderia phymatum STM815]
    MYSTQVCPYCQMAERLLKSRGVEHIEKVLIDKDPARRQEMMTRTGRRTVPQVYIGETHVGGYDDLSALDRAGGLTPLLEA
    VA

    >gi|186475056|ref|YP_001856526.1| electron transport protein SCO1/SenC [Burkholderia phymatum STM815]
    MLTERFARAARVAFVACALGGAALVSGCGKEQPAFTNVDITGNKQFGTDFSLPDSSGKTRTLADYKGKVVVLFFGYTHCP
    DV
    CPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTPELMAQYVPAFNPTFVGLRPADQAQLTKVTKDFRVYYAKVPG
    KSPDSYTMDHTAASYVFDTDGKLRLFARDGQGASPWVHDLKLLLG

    >gi|186475279|ref|YP_001856749.1| peptide methionine sulfoxide reductase [Burkholderia phymatum STM815]
    MSQSVETATLGGGCFWCLEAVFLGVDGVTSVESGYAGGQTDNPSYEQVCDGNTGHAEVVKVEFDPARISYREVLDIFFAI
    HDPTQLNRQGNDVGTQYRSVIFTHSDAQRETALQAIREIGAEGVYDGQIVTQVLSLDGNYWAAEAYHQNYFAQHPDQGYC
    AFVVAPKVAKFRQKFAHRIKAGA

    >gi|186475284|ref|YP_001856754.1| thioredoxin [Burkholderia phymatum STM815]
    MDTTLATFEKDVISASMLAPVLVDFWAPWCGPCKTLGPMLEKLEAEYEGKWRLVKVNVDENQELAAHFQVRSIPHVVAFA
    DGRPVDQFIGVLPEGQLRQFLDRLVPDGAEAARAEASIAIAEGRREDAYNALKAALAYDPGFDEARLDLMELLLEDNRID
    EAQNENDLLSPKTTQGIDARYNAIKTRLDAVDAAADLPPTGALEARVAENPDDLEARFDLASALIARRKYDPALEHLLAI
    VQRDRTFREDIGRKTMLSVFDLAAHQPELVGKWRRRLSALLN

    >gi|186475290|ref|YP_001856760.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia phymatum STM815]
    MFNAVIDAPFGKIGVRLESETVREIVYLPDSVANVEPDSPLAKQAVEQIEHYLQQASARFDLPLADVGTPFQRRVWKAIG
    EIPPGVVLTYGQLAKQIGSVPRAVGQACGSNFFPIVIP
    CHRVVASGGIGGFAHTGGDGYYRNVKRWLLKHEGVPYA

    >gi|186475400|ref|YP_001856870.1| thioredoxin reductase [Burkholderia phymatum STM815]
    MPASSTKHAKVLILGSGPAGYTAAVYAARANLSPLLITGLAQGGQLMTTTDVENWPADPNGVQGPELMARFLEHAERFNT
    EIVFDHIHTARLDEKPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEELFMGRGVSA
    CATCDGFFYKNQHVAVVGGGNTA
    VEEALYLAGIARKVTVIHRRDKFRAEPILIDRLLEKEKEGVVEIKWDHVLDEVQGNDGGVNGLRIKNVKTGATTDIELQG
    LFVAIGHKPNTDLFEGQLEMKNGYIITNGGLNGNATGTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYLESIHE
    SIGERAMSAEADR

    >gi|186475479|ref|YP_001856949.1| disulphide bond formation protein DsbB [Burkholderia phymatum STM815]
    MNIDNVKLRRERSLLVLLGLVCLALVGGALYLQFVEHEDPCPLCIIQRYFYLLIAIFAFLGARMRGWTGVRLLEVLALLS
    ALGGLLTAARHVYVQSHPNFS
    CGFDALQPIVDGLPPAHWLPSVFKVAGLCETPYPPILGISLPGWSLIGFAVIFVALTGS
    IWRNRRLR

    >gi|186475603|ref|YP_001857073.1| glutaredoxin 2 [Burkholderia phymatum STM815]
    MTNAIGPGASLTLYGRAWCHLCDDMRAALGPFLTEFGMQLEVIDIDADPALEARYNDWVPVLVLEGVELCHYHLDETRLR
    AALTAHSATPRR

    >gi|186475686|ref|YP_001857156.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phymatum STM815]
    MPIAVDQPVPDFTAPATGGDFTLSSLRGKKVVVYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIIGVSRDSVRSHDNFK
    AKLELPFTLVSDPDESLCTLFGVMKLKKMYGKEVRGIERSTFVIDAEGVLRREWRGVKVPGHVDEILEAVQAL

    >gi|186475715|ref|YP_001857185.1| thioredoxin [Burkholderia phymatum STM815]
    MSEHIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYADRLQIAKINVDEHQSTPVKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|186475765|ref|YP_001857235.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MEFIATIKEAIPDYAKDIRLNLDGTIARSSLEGNDAVGVALAAAFAAKSPKIIAAIREAGVLSPEEVNGALTAAALMGMN
    NVWYPYVEMTDSADLKSQPAGLRMNAYATHGGVDKRRFEMYALAASIIGKCHF
    CVKSHFDTLVKEGMSSTQLRDVGRIAA
    VVNAATQVIVAEDK

    >gi|186475766|ref|YP_001857236.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phymatum STM815]
    MKTVGDKLEAFTVTAAKPGFNHHEENGVSAFEEITESSFPGKWKIIYFYPKDFTFVCPTEIVEFGKLVKDFEERDAVLLG
    GSVDNEFVKLAWRREHKDLNKLNHYAFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|186475791|ref|YP_001857261.1| hypothetical protein Bphy_1026 [Burkholderia phymatum STM815]
    MSAAAGAIDNQREGSFAALGNVFLTRLPAAPLPAPYVVGFAPDVASMLGFDASLASAPGFSEFFSGNTTRDWPSTALPYA
    SVYSGHQFGVWAGQLGDGRALTLGEAEHNGRRFELQLKGGGRTPYSRMGDGRAVLRSSIREYLCSEAMHHLGIPTTRALC
    VIGSDQPVRREEIETAAVVTRVSPSFVRFGHFEHFYANDRVDALRSLADHVIDRFYPACRDADDPYLALLNEAVLSTADL
    IVQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFMDGFDANHICNHSDSQGRYAYRMQPQIAYWNLFCLAQGLLPLFGERY
    GEAERSERAVQDAQRVLEGFKARFAPALEARMRAKLGLDTEREGDDQLANKLFEIMHANRADFTLTFRNLSKLSRHDANG
    DAPARDLFLDRAAFDAWATEYRARLSHETRDDAERAEAMNRVNPKYVLRNHLAENAIRRAKEKDFSEVERLAAVLRHPFD
    EQPEHEAYAGLPPDWASSLEVS
    CSS

    >gi|186476108|ref|YP_001857578.1| arsenate reductase and related [Burkholderia phymatum STM815]
    MARASSKTTVVYGIPNCDSVKKARVWLEEHGVEFEFHDFKKAGVSNALVQDWLKDVPLEQLINKRGTTWRGLSDVHKAEA
    DTTAGAIALMIHKPSIIKRPVLVVNGRVKTLGFSAEQYETLFA

    >gi|186476112|ref|YP_001857582.1| glutathione peroxidase [Burkholderia phymatum STM815]
    MADKSSIYSFSARTLDGEPVSFERYNGKVMLIVNTASECGFTPQYAGLQKLHEQYAARGLQVLGFPCNQFGKQEPGDAAQ
    IGAFCEKNYGVTFQMFDKIDVNGSDAHPLFRFLKDEAPGVLGLEAIKWNFTKFLVDRDGKVVKRYAPTTKPETITDDIEA
    LL

    >gi|186476214|ref|YP_001857684.1| iron-sulfur cluster assembly protein IscA [Burkholderia phymatum STM815]
    MNGASRTLRNAMAITLTEKAAQHVQKYLTRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDEVFECNGVKIVVDPKSL
    AYIDGTELDFAREGLNEGFRFNNPNVKDECGCGESFRV

    >gi|186476226|ref|YP_001857696.1| dihydrolipoamide dehydrogenase [Burkholderia phymatum STM815]
    MSLVEVKVPDIGDFKDVDVIEVNIKPGDTIEKEQSLLTLESDKASMEVPSDTAGTVKEVRIKAGEKVSQGTVIAVVETSG
    EAKAVKEPEKAAPAPAAAPAVSGSGVQEIKVPDIGDYKDVPVIEVAVKVGDRVEKEQSLVTLESDKATMDVPSPAAGVVK
    ELKVKVGDNVSEGSVLLLLEGEGAAAAPAPKAAAPAPSPAAAPTPAPQAGSYSGSTDIECDMLVLGAGPGGYSAAFRSAD
    LGMKTVLVERYSTLGGV
    CLNVGCIPSKALLHTALVIDEAEALGSHGISFGKPQIDLDKLRDFKSGVVKKLTGGLAGMAKA
    RKVEVVTGVGTFVDPYHMEVQGENGKKIVKFKQAIIAAGSQAVKLPFIPEDPRVVDSTGALELRQLPKRMLVIGGGIIGL
    EMATVYATLGAQIDVVEMLDGLMAGADRDLVKVWEKFNSKRFTNVMLKTKTTGAEAKPDGIYVTFEGEKAPAEPQRYDLV
    LVAVGRSPNGKKIGADKAGVAVTDRGFIEVDKQMRTNVPHIFAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDAMQI
    PSVAYTDPEVAWAGKTEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCL
    AVEMGADATDIGKTIHPHPTLGESIGMAAELYEGVCTDLPPQKKK

    >gi|186476254|ref|YP_001857724.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia phymatum STM815]
    MPQHFDAIVIGTGQGGSPLAVRLAEQGRKTAVIERDKFGGTCVNVGCTPTKAYVASARTAHVARRALDYGVHVAGGVSVD
    LAKVKARKDQIIGQSRDGVEKWLRNTDNVTVFNGHARFTGAHTLSVTEPDSANVLAELQADDIFINTGTRAVIPQLEGIE
    RIRYHTNSTLLELTDLPAHLAIVGGSYIALEFAQVFRRFGSRVTVIVRGERVLAREDEDFARNVQTVLAREGVEFRFGGE
    PSRVEPLQHDGDGVRIFFGSEGAPLDASHLLFATGRSPNTDDLGLDAAGIEVERHGTIPVDGQLRTNVPGVWAIGDVNGR
    GAFTHTSYDDFQIVATNLFDGGKRSVDDRIIAYAVFVDPPLARVGLSEQDVRKSGRDALIATMPMTRVGRAREKGETDGF
    MKVLVDPSSKQILGATIYGVDGDEAIHTFVDIMTARAPYTTLQYAMHIHPTISELVPTLLAGLAPMQ

    >gi|186476477|ref|YP_001857947.1| dihydrolipoamide dehydrogenase [Burkholderia phymatum STM815]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENASHHLADHGIS
    VENVKVDIAKMLARKEGIVEKMTKGIEFLFRKNKITWLKGHGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARH
    LPNVPVDNKIVADNEGALSFTEVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPEFLGAADQALAKEAAKQFKKQGL
    DIHVGVKVGEVKTTANSVSISYTDKDGNAKTLDADRLIVSIGRVPNTDNLGLEAIGLKANERGFIDVDDHCATSVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCVPWVIYTEPEIAWVGKTEQQLKAEGREIKSGQFPFMANGRALGI
    NKADGFVKMIADAKTDELLGVHIIAANASDLIAEAVVAMEFKAASEDIGRICHPHPSLSEVMREAALAVDKRALNM

    >gi|186476533|ref|YP_001858003.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phymatum STM815]
    MQQKIVPFALAAALCAGLSLHALTAFATLKPGDNAPDFTTQASLGGKTYTYALADALKQGPVVLYFYPAAFTKGCTIEAH
    EFAEAVDEYKKYGATVIGVSHDNIDTLTKFSVSECRSKFPVAADPDSKVINAYDAGLPMHASMANRVSYVIAPDGKIIYE
    YTSLSPDKHVENTMQALKQWAATHKQP

    >gi|186476705|ref|YP_001858175.1| OsmC family protein [Burkholderia phymatum STM815]
    MADTKVTAHIGSTNFQVLFDDGAHTWLADEPESLGGGDRAPTPNSLLLSSLGACTSITLKMYAQRKGWPLDEVRVTLSMQ
    KEGDGTAIDRQIVLTGNLSDEQQERLLQIANA
    CPVHKILTNPISIRTGLAVA

    >gi|186476723|ref|YP_001858193.1| heavy metal transport/detoxification protein [Burkholderia phymatum STM815]
    MNIEFKVEGMSCQHCVAAVTRAIQEQDAGAQVQVDLSAGKVAVQSGASADTLKAAIDEAGYTVVGVNSN

    >gi|186476834|ref|YP_001858304.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MRDNTRSIPFFAVRVLRPPSMRAPGTALYRWTSMNILNLSAYQFSTLDKIVEWRPLVTARCNELGLRGTILLAPEGINLF
    IAGEIPRVRAFIDYVRHDPLFEGKFSELQFKESLSEKQPFRRMLVKLKREIITMKKPAIKPELGRAPFVDARTLKVWLDR
    GHDDAGRPVVMLDTRNAFEVDVGTFDNALDYGITRFSEFPEVIEQNRADLEGKTVVSF
    CTGGIRCEKAAIHMKDVGIENV
    YQLEGGILKYFEEVGGAHYNGECFVFDYRTALDPNLRPTATVQCFGCRAVVMPEGQKSPYYVPGKTCAACHPDAQPQAAA
    AHAADLV

    >gi|186476998|ref|YP_001858468.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MQNLTAPALAEWLADKSRPTPVLLDVREPWEIETAKIAGSVSIPMREIPARSEELDDDVQIVCICHHGARSAQVAMFLES
    RGHKDVFNLYGGIDAWSRQVDPSVPTY

    >gi|186477188|ref|YP_001858658.1| peroxidase [Burkholderia phymatum STM815]
    MSLRLGDVAPDFEQESSIGRISFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLANEFEKRNVKTIALSVDSKDSHNEW
    IKDINETQAASVGFPILADGDRKVSQLYDMIHPNANETLTVRSLFIIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DNYQVATPGNWKHGDDVVIVPSLKDEEEIRRKFPKGYKALRPYLRLTPQPNK

    >gi|186477310|ref|YP_001858780.1| iron-sulfur cluster assembly accessory protein [Burkholderia phymatum STM815]
    MDAVTDTPVTEMPAPFVFTDAAADKVKELIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEAINEDDTVMNKSGVQLLIDS
    MSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV

    >gi|186477313|ref|YP_001858783.1| OsmC family protein [Burkholderia phymatum STM815]
    MECKVSWMGQDGMAFAAETGSGHLVAMDGAPEGGGRNLAPRPMEMVLLGTGGCTAYDVVMILKKSHQEITGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGKNLNPSTVERAINLSHDKYCSASIMIAKTAQLTHSFDIVAG

    >gi|186477375|ref|YP_001858845.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MKRILAVAAVAVVATVGGAVAGHWLLGNNDIAGVANAAPADSAVAVNQLWAAKVTNADGAPQSLAGFKGHPVVVNFWASW
    CGPCVEEMPSLSALHKEYSKKGIEFVGLGVDSDKNIKAFLQKVPVSYPIYVAGFGGADLARAFGNNAGGLPYTVVIDAKG
    VVRSTKLGQIRPDELKRTLDAL

    >gi|186477381|ref|YP_001858851.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MSQVTLGGNPIEVAGTFPSVGQAAPAFSLVGKDLKPLTLGDFAGKRKVLNIVPSLDTPTCATSTRKFNEAAAKLNNTAVI
    VVSGDLPFAATRFCTTEGIENVVTGSTFRGHEFAQAYGVDVTSGPLTGLTARAVVVIDENDKVVHAELVGEIKNEPNYDA
    ALAALK

    >gi|186477415|ref|YP_001858885.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MIQVGEKLPPATVYELIEDAREGCTIGPNSFDVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEQADKLHAAGIDEIWC
    VSVNDAFVMGAWARDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLHVEAPGKFEVSDAA
    SILATLSQP

    >gi|186477454|ref|YP_001858924.1| putative thiol-disulfide interchange protein, DsbC [Burkholderia phymatum STM815]
    MKKSIRIAALALAVATLGLGCSAQADQTTDKLKSTLQARLSEATIKNVSKSPIDGLYEVNLGSQIIYSDASGDHLILGDM
    IDAKTRKNLTEARLSETNRIDFASLPFANAVKVVKGNGSRKIAVFSDPN
    CPYCKQLETTLKSMDNITVYTFLYPVLSPDS
    TVKSKSIWCSADRAKAWESWMQDHRAPTAPGTCDTAAIDRNLALGQSMNVSGTPTVFLADGRRLPGAVPADELDKALSSV
    R

    >gi|186477471|ref|YP_001858941.1| glutaredoxin-like protein [Burkholderia phymatum STM815]
    MDTQQRIKQIVDENSVVLFMKGNAQFPMCGFSGRAVQILKACGVDQFKTVNVLEDDAVRQGIKEFSNWPTIPQLYVNGEF
    VGGSDIMMEMYQSGELQQLFAAA

    >gi|186477488|ref|YP_001858958.1| glutathione S-transferase domain-containing protein [Burkholderia phymatum STM815]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVGTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|186477558|ref|YP_001859028.1| protein-disulfide reductase [Burkholderia phymatum STM815]
    MYNRLSRRWRDVARVFAVIAGFLLLSFSSVGVVRADDFLDLSEAFRFSASEQPGEVLVHYKIADGYYMYRERFAFATRNG
    AGKLGDAQLPAGHVKFDQTFNKNVETYRGELTIRVPVSQASGAFDLAVTSQGCADAGICYPPMERVYHVSGAALHAAAAG
    TVQLSPPHEDSSGNASWYERATSADYAQSLLQGGGFFAIVGLYFVAGIVLSLLPCSYPMIPILSAIIIGEGPRVTRARGF
    ALSLAYVVGMALVYTVLGVAAALVGQSMGARLQNPWVLGAFAVLLTVFALTLIAGVDIVLPHGWQRGVSKASEGRSGGKF
    AAVAVMGALSALVVGACMTAPLFAVLAFIAHTGNAVLGGVALFSMGIGLGVPLLLIGLGAGTLLPRAGAWMDRVKVFFGV
    ILLAAALWIVWPVLSSTAQMLLAASWLLIAAASLGLFSPHAGAGSIWRGLGRGLGAALAIWAATLLAGLAAGSTDPLKPL
    AVLVGRTSGTASEQAQQSDLAFARVRSSGQFDEAVKTAAKPAMLDFYADW
    CVSCKEMEKFTFSDPRVQAKLKQFNLLRAD
    VTANNADDQALLKRFNLFGPPGIIFFDRGGKEVLRVVGYESADKFLNSLARMMPGPQT

    >gi|186477832|ref|YP_001859302.1| AraC family transcriptional regulator [Burkholderia phymatum STM815]
    MNTAFSHAVPATFHNEDERWAAVLKRDMSADGAFFYGVRTTGVFCRPSCASRLPRRENVDFFESADDARAAGYRECKRCQ
    PGGLPRELEIVKRACATLDAYPQQRLTLAQLSDAVHISPFHLQRLFKRVVGVSPRQYQAAQRGAAFRDALQRGADVTRAT
    VDAGFGSPSRMYDTAAAELGMAPSEYRRKGAGLRVRYASALTSLGFVLVATTDKGICKIAFGDDEAPLIDDLRQEFASAE
    LLGDPVRLAPFIEQIDAYLQGKRERFDLPLDIAATAFQQRVWEALRRIPYGETRTYSQIAEAVGLPRAVRAVANACASNP
    VALAIP
    CHRVVQKGGALAGYRWGTARKATLLDTEAQRESSTADEATPTTADMDHAA

    >gi|186472082|ref|YP_001859424.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MIKVGDTLPDVRLFEFIDEATEGCAVGPSAFSVRKRAAGKRVVIFGLPGAFTPTCSARHLPGYIDAAADLFAVGVDEIWC
    VSVNDAFVMNAWGRQQATAGKIKMIADGSAHFSHALGLEQDLTARGMGIRSHRYAMVVDDGVVATLNVEAPGEFQVSDAE
    SIMAVLR

    >gi|186472398|ref|YP_001859740.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MSKRLDYTQIAPAGVKALGGVYGYVLQSGLSPVLVDLVYLRVSQINNCAYCLDMHTRDLLKKGVKVEKLALVQAWREAGH
    LFDDRERAALAWAESVTLVAQTGVPDEAYDAARAVFNDRELVDLTIAISLMNTYNRMAISFRNTPQAVMET

    >gi|186472495|ref|YP_001859837.1| alkyl hydroperoxide reductase, F subunit [Burkholderia phymatum STM815]
    MLDANLKTQLKAYLEKVSRPIEIVASLDDGTKSQELLALLNDIASLSERVNVIERRGDDERKPSFSIGEPGKTTGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDAVIQQIRELDGDFAFETYFSLS
    CQNCPEVVQALNIMALINPRIRHTAIDGALFQ
    NEVESRQIMAVPTMFLNGEVFGQGRSGVKEILAKLDSNAGARAAKELEKKPVFDMLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRAEALIPGKINEVRLAGGAVLKAKTIVLATGA
    RWREINVPGEREYRNHGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGVVNHVTLIEFGATLRADEVLQRKLRSLP
    NVVVITQAQTTEITGDGKKVNGLTYTDRVSGESKHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRTSVEDAEDAQAAAMAEV

    >gi|186472496|ref|YP_001859838.1| peroxiredoxin [Burkholderia phymatum STM815]
    MPIINSQVKPFKATAFHNGDFVTVTDETLKGKWSVVVFYPADFTFVCPTELGDLADRYEEFKKLGVEIYSVSTDTHFTHK
    AWHDTSDTIQKIKYPMVADPTLAISRNFDVLIEEEGLALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLSPSLDLIGKI

    >gi|186472579|ref|YP_001859921.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phymatum STM815]
    MTSSANIATDSPANTDVLIIGAGPVGLFAAFEAGVIGLSSVIVDNVERAGGQCIELYPDKPIYDIPAIPSCTARELVDRL
    LEQCRPFAPPLHLGHRVDTVEQLDNGRWLARTDKGLTVESAAILIAAGNGSFVPQRLQLDDAAPLEGHYVHYSVSNLADF
    AGKKMVVAGGGDSALDWALALRTVAQHVTLVHRRNGFSATDSSVANMRRAVEAGEMNFAVGTIASLNAPGGQLESIELRQ
    AEGSVQLATDHLLVLFGLVADLGPIQQWGVEVRGGRITVDTSNYESSRPGIFAAGDIAGYPNKQKLILSGFHEASLALRK
    AYSYAYPDKKRVHIHSSYDAKLAERVAASHT

    >gi|186472646|ref|YP_001859988.1| methylamine dehydrogenase accessory protein MauD [Burkholderia phymatum STM815]
    MMQTALSVSTALLWIAVLALGAISLALVRQVGILYERIMPAGALMIDKGPAVGAIAPTFELSDIRGQQVKVGGIDAQGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQSSESTPVNIVLASDGDVAEHQRFAQKQNLDRFPYVLSQELGIAYQIGKLPYAVLLD
    ESGKVRSKGLVNTREHLESLFEAKERGVASLQEFVHGDHRHEQREQHA

    >gi|186472687|ref|YP_001860029.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MQLVDLQPSAVSTWGAAVVFANVLLTRLGIPVPAVPMLLLAGTAIANGHLSFWHVLTAALAGALIGDGAWFTAGRLLGRK
    LIQALARLSASVETRMRKARALFVRFGPAIVSVSKFVPGLAIITPPLMGTTRVGIVIFFAWDAVGIIAWATFWLLGGAIF
    ERQLSRLIYEVRVHGWTILDVLFVITACYLAFRFMQRWRMQQPLLLAPVAPEQVDAMMRADKPPIVLDARPEEVKRETPQ
    SVPGAVPLDIRSPDAVDAALLARDVVVYCM
    CADDATAKALAQKMRNRGYTRVRALRGGLDAWERRGYVVEPSDESGNAAA
    HSMREKSRTSPQQPGITLRGIAPRRLHSTAF

    >gi|186472779|ref|YP_001860121.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MPHTHYTTLISAGNLAERLAAAPGSVFIADCRFDLVDTAAGEQAYAAGHLPQAHYLHLDRDLSGAKTGSNGRHPLPDRQT
    LVDRLAALGLKQGQQVVAYDAQGGMYAARLWWLLRWLGHDSVALLDGGLQAWEAAGQPLTQEAPPKATGDFKAGAPLAVT
    VDAHAVERNIGTKERVVIDARAADRYRGENETLDRVGGHIPGARNRFFKDNLTADGRFKSAHNLRDEFNAVIPAGVSAEH
    VVLQ
    CGSGVTACHNALAMEIAGMHGAALYPGSWSEWSSDPARPIATGPNP

    >gi|186472816|ref|YP_001860158.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MERLNRQPVAEATGQAAELFAGIKRAVGMVPNAYAAIGSNSPAALQIVLATGDALGKGALSRKEVEAIKLAISGVADCDY
    CLAAHSLAGKKVGIAADDVAALREGRDSADAHLNAIATFARTVFSSRGTVPAAVVDAVKAAGYSDQQITETLLAIADITF
    TNLFNRVNDTVVDFPKI

    >gi|186472887|ref|YP_001860229.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MEQRLDFYKANPHAIKALLALEERINKSDLEKSLTELVRLRASQINGCAFCVDMHTTDARKGGETERRLATVVVWRETPF
    FTARERAALEWTEALTLISQDHVPDAVWDAVKPHFSEAELVDLTLLVSAINVWNRFAISFRKMPA

    >gi|186472935|ref|YP_001860277.1| thioredoxin domain-containing protein [Burkholderia phymatum STM815]
    MTTANQYSKTAPSRADVDAMTGVTVVEFGTDWCGYCQAAQPVIGNAFSQHSGTRHLKIEDGPGRPLGRSFKVKLWPTLIF
    MRDGVEVARVVRPTDAAQIEEAFTATV

    >gi|186472975|ref|YP_001860317.1| arsenate reductase [Burkholderia phymatum STM815]
    MITIYHNPRCSKSRSACELIGDVYNPSNEPVEIVEYLRTPLSVAQLKELNRMLGSPVREMIRDSEPIYKELGLADTSLTD
    DQLYEAVATHPILLQRPIVVRNGRAVIGRPPENVNALFADQAK

    >gi|186473090|ref|YP_001860432.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MLHDLVEQYGPAIVFVNVLAASIGLPVPAMPALVLFGAMAAMHPGSVGTQVLPVLVLAVFATLIGDSAWFAAGRIYGGNT
    LKTLCKLSLSRDTCVKKTERFFGRWGVRVLAVAKFVPGLSIVSIPMAGAMGTPYRTFLAYDSIGATLWSGLGLVLGVVFA
    QQIDMLFAGASRLGKLTAVVVVVLLAVYCTYRWYRRRQLIKKLATARMDVDELYNLMLDKRSPVLFDIRSQEKRALDPFV
    IPGSVFADERQLEEIVAKYPRDQKLVIYCS
    CPNEVSAAWMAKQLTEAGFQDVIPLRGGLDAWRDAGRQLEPLAEELAPAV
    AVGITPKTV

    >gi|186473092|ref|YP_001860434.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia phymatum STM815]
    MQEDLMKQCMSMPSPLGDILLRAEDDALTGVFFIGQKYFPAADCALAAHGESRVLHQARAQLDEYFAGERTTFTLPLRML
    GSAFQRDVWEQLVQIPYGETASYGAIAQRLGLPLAASRAVGSANGRNPISVVVP
    CHRVISSAGELTGYAGGLHRKEALLR
    LERPMSKAPQQLELLASG

    >gi|186473136|ref|YP_001860478.1| heavy metal translocating P-type ATPase [Burkholderia phymatum STM815]
    MTELATPRTAAPSRPAASPELDIQGMTCASCALRVEKALAKVPGVARASVNLATEKATVDADASVAVDTLVSAVRKAGYD
    AQPAQRAALPASDGGSTTETAELAIGGMT
    CAACSGRVEKALARIPGVTSAAVNLATEKATVTTNGAVGVDQLIAAVTKAG
    YQATPLSADEAAPGVTEDKDAAVRRELGAVVICALLTLPLIVPMFAEPFGLHAMLPATLQLALATVVQFVFGARFYRAAW
    KAVRAWSGNMDLLVALGTSAAYGVSVYQLALHPGDTMHLYFEASAVVITLVRFGKWLEARAKRQTTDAIRALNALRPDRA
    RIVVGTQEHEVPLAQVRVGMKVAVRPGERVPVDGKVVQGRTHIDESLITGESLPVPKQADDRVTAGSINGEGAITVATTA
    IGGETTLARIIRLVETAQAEKAPIQRLVDRVSEIFVPAILAIALVTLLGWLLAGHSAEAAILNAVAVLVIACPCALGLAT
    PTAIMAGTGVAARHGVLIKDAQALEIAHQVRVVAFDKTGTLTVGKPSVTAFETAQGIDRAQALALAAAVQRHSEHPLAKA
    VMNAFTAESADDQHTPLPAGSDARAIAGRGVEADIDGETFAIGSSRWLDELNVTPTAALAGRARELEAQGNTISWLIKRG
    DADAPTQAVALIAFGDTLKPGARTAIERLSQMGVKSALVTGDNEGSATSVAAALGIDEVHAQVLPSDKARVVHDLKIRTS
    SVVAMAGDGINDAPALAAADIGIAMATGTDVAMHAAGITLMRGDPALVADAIDISRRTWSKIRQNLFWAFVYNLIGIPLA
    AFGLLNPMIAGAAMAFSSVSVVTNALLLRTWRSTH

    >gi|186473441|ref|YP_001860783.1| selenide, water dikinase [Burkholderia phymatum STM815]
    MNEPAVTSNVPRLTSLSHGGGCGCKIAPGVLSDLLKRNLPRPSFPDLLVGTETSDDAAVYRLNDEQAIIATTDFFMPIVD
    DPYDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHDVIAAVLRGGEDVCTLAGIPVAGGHSIDSVEPIYGLAALG
    VVHPKRVKRNASAQAGDVLVLGKPLGVGVLSAALKKNQLDEAGYAAMIAATTKLNRPGAELAALDGVHAMTDVTGFGLLG
    HTLELARGAQLTARVRYADLPWIAGAEAFAAAGVFTGASGRNWASYGDDVRLAGALPDTARPLLTDPQTSGGLLVSCAPA
    AVDDVLAIFRADGFERAAVIGELLDGAPRVEVM

    >gi|186473454|ref|YP_001860796.1| hypothetical protein Bphy_4640 [Burkholderia phymatum STM815]
    MQASFAATAVAVLAGSYASVWRVPMRSLIAAVAGAPRPGYGARRADGCHIGAYFRGVLSGSLHAGYCSSPRSPASWSERG
    RTRFSGSKGTEFPSPGS

    >gi|186473549|ref|YP_001860891.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MAPSTVSAIPAADSTTALAHFESSLRFETDCWDVSDSLASGNPDFVLLDVRSPKHFAHGHIPGALNLPHRKITESKLREY
    PPDTLFVTY
    CAGPHCNGATRGAIRLAQLGRPVKIMIGGVTGWLDEGLVLQTQAASGCTEVRQQP

    >gi|186473827|ref|YP_001861169.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MLLIVIAFLGGVLTILSPCILPVVPFVFARSDRPFVTGRLPLLIGLAVTFAVVTGVGVAGLAGAARLSHYGRGVSLALFA
    VFGLSLLFPALWTRVSRPFFDIGNRVEAFSHAQGTRFQVVSALLLGAATGLLWAPCAGPILGLILTGAALHGASWTTAAA
    LTAYAFGAASSLAVASGLGKQALDGLKRSLGFGERVRRFMGALVLLSVVGIGFGFDTRALAHVPSTSTTGVESRPVGLLS
    ADGGSRPHLQRVSVQTPSKLPVEGTLPSLDGAQSWLNSPPLTADALRGKVTVVNFWTYS
    CINCLRTLPYLKTWSDRYGQD
    GLVVVGVHTPEFAFERDPSNVKRAVRDLGIRYPVAIDNGYGIWQAFGNQYWPAFYIVDAQGRIRYHHFGEGGYGEAEKVI
    QQLLADSGHTMPTGDLPPIHGAGAQAAADASNVESGETYVGYQQARGFASPQDIRPDDAASYSIPSQLPLNSWAFGGRWI
    VGGEAAVASEANGRIAYRFHARDLHLVLGPGANGKPVRFRVTIDGAAPGDSHGADIAADGTGVVTSARLYQLVRQHDAVR
    DRTFTIEFLDPGVQAFSFTFG

    >gi|186473953|ref|YP_001861295.1| carboxymuconolactone decarboxylase [Burkholderia phymatum STM815]
    MNTFNAYTIDTAPANSKPLLEGTKAAFGFVPNLQSFMAESPELLAGYSALWDLFSKSTLTPHEQQVVYLTSNFENDCHYC
    MAGHSTLAKMIKMDPAVIDALRAGTELPDAKLEALHRFATIVVRERGFACDADVDAFLAAGYTRRNVLEVILGVATKVMS
    NYTNHVVHTPYDAFMKGNAWTKPQTAVAAGF

    >gi|186473954|ref|YP_001861296.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phymatum STM815]
    MALQDKLDAFKADFKGGKPPYYAPPEIHPIMERATAELIASGQAARATRAGDRAPSFTLKDQDGNEVSSAELLGRGPLVI
    TFYRGVW
    CPYCNIELQAINDALPQIEAYGASVVAISPQTAVNSRKSVRDNKLGFPVLSDTNGEVGAAFGLRFALPDYLVD
    LYKALKNDLPAFNADPSWTLPMPARYVIGQDGIVLYSEVNPDYTHRPDPADMFPVLERANAKV

    >gi|186474010|ref|YP_001861352.1| OsmC family protein [Burkholderia phymatum STM815]
    MKRKASALWQGGLQDGKGSISTDSGVLKDTQYSFATRFENGIGTNPEELIAAAHAGCFSMALSAELGKANIKPERIATTA
    TVTLDKDGGGFAVTASHLDVVVKIPGGDKAAFDKAAADAKAG
    CPISKVLNATITMDAKLET

    >gi|186474136|ref|YP_001861478.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia phymatum STM815]
    MKTLHIDVAVIGAGSAGLPAFRAAKAAAARAVLIEGGAYGTTCARVGCMPSKLLIAAAEAAHAARSTAPFGVHVDGAVRI
    DGREVMARVKRERDRFVGFVVESTQSVPDEERLIGYAQFIDDNVLQVGDHTRVHAKSVVIATGSSPYVPAMYQALGDRAI
    VNDDVFAWDDLPRKVAVVGAGVIGLELGQALAWLGVDVTMLGARGRVGPLSDPAIKGYARHVFSDVFHFEPDAHVEAATR
    EGDSVHLRYRDGAGELREDTFDYVLVTAGRRPNLDKLALHNTTLQLDARGVPVFDPLTLQAGRHPVFMAGDANDVLPLLH
    EAADEGRSAGENAARFPDVKPLLRRAPISVVFSEPGMAMVGARHADLAAGAFVTGEVSFEDQGRSRVMLRNRGLMHVYAD
    KATRRFLGAEWIGPDAEHIAHLLAWALQMNLTVDAMLAMPFYHPVVEEGLRTALRDAAAQLPKA

    >gi|186474138|ref|YP_001861480.1| glutaredoxin 3 [Burkholderia phymatum STM815]
    MSAITIYTTPTCPYCHAAKALLMNKGLSYREVDVQNDRVTAVALMERTGRRTVPQIFIGETHVGGFDDLNALETAGRLDR
    LLEANAPDHAAR

    >gi|186474204|ref|YP_001861546.1| peptide methionine sulfoxide reductase [Burkholderia phymatum STM815]
    MNRKLIANALRSTRTSAGRIAACIAIGAGAIAWQHVASAEQAVRIPAPAQDEKPGAAHTETAVFAGGCFWGVQGVYEHVK
    GVQQVASGYTGGAANTAQYETVSDGETGHAESVRITYDPTQITYGRLLQIFFSVAHNPTQLNYQGPDHGTQYRSAVFPQN
    AGQRAIVQAYIAQLNNAKVFSAPIVTKVEDFKGFYPAEQYHQNYLVLHPDSPYIAINDLPKITHLKQMFPDVYRDDPVLL
    KASAS

    >gi|186474205|ref|YP_001861547.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MLLIVLAYLGGALTILSPCILPVLPFVFARADQPFVRTGLPLLGGMALTFALVATLAAVGGGWVTQANQYGRWIAIVLLG
    VFGLTLLLPRFADRLMHPLVSAGNRLTTLARTDGSQPRIGSSFLLGIATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LLAYAAGAATSLAIALLIGGKVFAAMKRSLGAGEWVRRGIGAAMLCGVVAIALGFDTGVLTKVSTVATSGIEQHLLDKLS
    PPKPAANEAMMSANLPAITQAAGVTPPAGTMMRASTAAAPLPVEGTLPQLTGAVQWLNSPPLTAGQLRGKVVLVDFWTYS
    CINCLRSLPYVKAWSQKYRDMGLVVIGVHAPEFAFERNIDNVKKAVHDLGVDYPVAIDNNYAIWRAFGNQYWPAHYFIDV
    QGRIRHHHFGEGEYEQSEKVIQQLLADAGHPEAAQVATGLEQHAKGVEAAADGNDMMSPETYIGYARAENFMSPGGEARN
    RAHAYTEPSSPDVNDWGLAGTWKVGAEHATLAAPDGRIVYRFHARDLHLVLGPGAGGRPVHFRVTIDGAAPGDARGTDVN
    ADGTGIVTEQRLYQLVRQTGDVADHTFAIEFLDPGVEAYAFTFG

    >gi|186474206|ref|YP_001861548.1| methionine-R-sulfoxide reductase [Burkholderia phymatum STM815]
    MKSRRQFLLSGGSALATLAALTHWRAFASGAPAAPDASGGAAARFEVMHSDAQWRQMLTSAQYHVLREEGTERPFSSPLN
    DEHRSGLFACAGCSLELFSSRTKFDSHTGWPSFWAPLDHAVATREDGSWGMVRTEVHCRRCGGHLGHVFDDGPKPTGLRY
    CMNGLAMTFTPRAV

    >gi|186470405|ref|YP_001861723.1| OsmC family protein [Burkholderia phymatum STM815]
    MSIEKVLYRAHAHATGGRDGRAVVPEGKLDFKLVTPRELGGAGGEGANPEQLFAAGYSACFLGAMKFVAARDKTPIPADV
    SVDGSVGIGAIPNGFGIEVELKISLPGMPHDAAQALIDKAHIV
    CPYSNATRGNIDVTLTLV

    >gi|186470483|ref|YP_001861801.1| OsmC family protein [Burkholderia phymatum STM815]
    MSLEKALYTAHATATGGRDGRATVPDAGLDFKLTTPKELGGKGGEGANPEQLFAAGYSACFIGAMKFVAARDKIAMPADA
    SIDSSVGIGTIPNGFGIEVAMKISLPGMDRDAAQDLINKAHVV
    CPYSNATRNNIDVTLTLV

    >gi|186470486|ref|YP_001861804.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
    MYSRFKTLATVVAVAAIAALGAVVANSGAATAVPVDKNRAAPEFTGINQWLNSRPLTMQQLRGKVVLVDFWTYTCINCVH
    TLPHVEKLYEKYKDQGLVVIGVHTPEYAFERETKKVSAAIAEYGLHYPVAQDNSYATWNAYGNQYWPAVYLIDKQGHIVY
    SHFGEGDYDQIDAAVREQLARPGQAG

    >gi|186470557|ref|YP_001861875.1| DSBA oxidoreductase [Burkholderia phymatum STM815]
    MQAVQIAFAYDFICPWCWIGHTNLNAGMQAAAPGAPVEVRYLPFELNPSMPVQGMDRRAYRAQKFGSWARSQMLDAQATA
    AGVAAGLAFDYAKVARTPNTRRAHQFMQFAMLHGDRENVARVFDAIFAAYFSQGRDIGSIDTLVAIAQEQGFDASRARAW
    LISDEGNRALTGAQSCPQRAVINSVPTVWIDGISISGAQPPAVFAHALRAAVTQGSTA

    >gi|186470601|ref|YP_001861919.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia phymatum STM815]
    MRCIRFCAHHNPGGVVSIDMGNFTPVFSLAGGLVIGAAAAVLVLFNGRIAGISGILGGLLRASCDDAGWRVAFIAGLIAA
    PVLASLFGKPITLDIQAGWGEIVVAGFLVGIGTRYGSG
    CTSGHGVCGISRGSVRSLVATATFMGAGFLTVFVLRHLAGG

    >gi|186471011|ref|YP_001862329.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia phymatum STM815]
    MLVDLGHFTPGLSLTGGLLIGAAAAVLILFNGRVAGISGIFGGLLNWPRDDVTWRLAFLAGLVGAPVIAALLGEPAQAEI
    ETSWGAILAAGFLVGMGTRYASG
    CTSGHGVCGLSRGSVRSLVATATFMSAGILTVFVQRHLIGG

    >gi|186471015|ref|YP_001862333.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MTDNVLVSPAELVDMSKSVAVVPIDTRDAASYAEAHLPGAVNIHEIFTYLATSTREGLTALRETFTKAFGDAGLSGDETA
    VIYEQSMATGFGQSCRGYVLLRYLGYPKDKIKVLHGGFAAWRAAGLPATTEVPATRGAAFPVDTAGSGILVDLTTMKDAV
    SSPDVVKLDVRDVDEWIGESSSPYGKDFCPRKGRIPGSVWIEWYRMMKPTPTGQMFKSPKEILAECATVGISRESPVIVF
    CFKGARASNTFLALEEAGIKDVKLYFGSWNEWSRDPLLPIEQGLPYKDDRVVATP

    >gi|186471057|ref|YP_001862375.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MSRIAIPAVQNATGGTAEVYGRVRKIAGGSVPNLFAALGHLAPAILNAALDAEGALASSSLSKQDLETIKLLVSEQTGCD
    Y
    CVAAHVMLGKMTGLSPEALKHIRAGQATGDVRRDALIRFVLTLQTTRGTIAESELAAIRAAGYSDTQLAEISLAIAMTI
    FTNTFNRINDTDVDFPPVK

    >gi|186471058|ref|YP_001862376.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia phymatum STM815]
    MSQVEQFDTLILGSGQGGKLLAWHLGRSGQRVAVVERQWVGGSCPAVACLPSKNEIWSARVAHLARHAADFGATTGPVAI
    DMAKVRERKRGMVEREAAFHVQAYESSGAELVMGVGRFVGPKTVEVQLNDGGTRTLSGRQVVVNVGTHAAIPDVPGLRAA
    EPLTHIGALDLDRAPSHLIVLGGGYIGVEMAQAYVRFGSHVTIIERSTRLMAREDADVGAEMLRILRAEGIDVVLDARTV
    SVEGRSGTQVRVVVRTPSGDRTLDGSDILVAAGRVPNTASIGLEHAGIQLDERGYIRVNDRLQTSAPDVWAIGEVAGSPQ
    FTHVSVDDFRIVRDNLAGGNRGTGDRLIPYTLFTDPPLARVGLSESDAQRQGIAVRVATLPMNNVLRTEATDETQGFMKV
    LVSANDDRILGFTMIGSEAGEVMAAMQTAMLADLPYQKLRDAVISHLTVAEGLGALLSRVPERTGE

    >gi|186471167|ref|YP_001862485.1| OsmC family protein [Burkholderia phymatum STM815]
    MSNKKLEAPPLPQLDRYRGRDFAPLYTTTVTVSGGTTGHGRASGVARSDDGNLDLVLRLPEELGGCGDGTNPEQLFAAGF
    AGCFHGALNLLGKRIGIELDDMAVDVQVAFGRDPMDGGYALAIDVRVRVPGVERAVVEELVRNAERL
    CPYAKMARQGTVN
    IVAVVD

    >gi|186471182|ref|YP_001862500.1| DSBA oxidoreductase [Burkholderia phymatum STM815]
    MTQPLRIDFVSDIACPWCAIGLSSLRLALERFGDAVDAQIVVHPFELNPQMGPEGEKIVDYLGKKYGRTRAQIEETQAMI
    RERGASVGFAFGPRAYVYNTFDAHRLLHWAGIEGRQLPLKLALLQAYHGDGKDPSHHDVLVEAAQSVGLDGEKARSVLTG
    GDYADEVRAEEREYQAMGIQSVPSIIFNQRYLVTGGQPVEAFEEVIQQILAEGNAGA

    >gi|186471360|ref|YP_001862678.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia phymatum STM815]
    MATESPPGQLGVKAPRFTLPATDGRSYTLDDVRGPNGLVVVFMCNHCPYVQAALPRIVRDAQDLAKLGIGTVGINSNDGI
    AYPEDSFERMIALAAELHLPFPYLYDESQQVARAYDAVCTPEFYGFDSELSLRYRGRLDASRKDPLPEADRDLFEAMQQI
    AQTGRGPDTQHPALGCSIKWKFE

    >gi|186471378|ref|YP_001862696.1| hydroxyacylglutathione hydrolase [Burkholderia phymatum STM815]
    MLIFRQLFDQQSSTYTYLLADSDTREAVLIDPVFEQARRDAALLEELRLRLLYTIDTHVHADHVTGAWLLKKHTGSKIAI
    SAASGAEGADHYVSHGDTIAFGARHLQVRATPGHTNGCVSLVLDDGSMAFTGDCLLIRGTGRTDFQSGNPHALFRAVHEQ
    LFSLPDTCLLYPAHDYRGLTVTSVDEERRFNPRLGGELCEEDFAVYMTNLGLPHPRQIDVAVPANMKCGVAASDPSQKPL
    PEWAPLTYTFAGIWEIHPQWLEEHLQAVQIIDVREPDEYEGPLGRIPEAKLISLGNLAKRTAELGKERPIVTV
    CRAGGRS
    AQATVILRQAGFEEVANLAGGMLRWRAEGRVVENGSL

    >gi|186471379|ref|YP_001862697.1| peroxidase [Burkholderia phymatum STM815]
    MAIRLGEVAPDFTAETTEGTIHFHEWIGDSWAILFSHPKDFTPVCTTELGYMAGLKPEFDKRNTKIIGLSIDPVSDHQKW
    VKDIEETQGNAVNYPMIGDHDLKVAKLYDMIHPEASGGGPRTAVDNATVRSVFLIGPDKKVKAMLVYPMSSGRNFDEVLR
    LLDSLQLNAKHTVATPVNWKPGEDVIIPTSVSDDAAKEKYPQGFKTLKPYLRYVQQPK

    >gi|186471389|ref|YP_001862707.1| OsmC family protein [Burkholderia phymatum STM815]
    MTHIEKVLFTGKTLTTASRHAGATRGHEGSLDIRLSAPGHAAHPDHVFESAQPHPTAEQLFAGAWSACLITAIGLAAKEK
    RVALPADLALEVAIDLGMTGNAYFLGARIDVSMPGVARDVAEAVVHAADDM
    CPYSKATRGNIDVAINVI

    >gi|186471402|ref|YP_001862720.1| rhodanese domain-containing protein [Burkholderia phymatum STM815]
    MWHFPTAIPASLGPWAVFLSVLITQLGVPVPAAPMLMLAGTMAAMGQVSYAAVFGAAVGATLLANSLWFFVGRVRGRRLL
    NGLVRFSLSLDTTLRMARGVFERHGAPILTLAKFLPGLGLISAPLLGTTAIAPGVFLLWDAVGASLWTGAYLIGGAALHD
    EIVQAMLLVRHNGGTIFDAFAAICVTVLLYRWVRRTQFRRWLAKMRISPDQLDTMMRSDAPPLIFDARPRSVREKEAYRI
    AGAYPLDLDSPEKLDATLLAHPIVVYCV
    CPSEATAKRIIGQLHRKGIHHARALKGGLDAWEKRGYPVEPLPADFYTSVER
    LGIEVPEGEYTVRATMPG

    >gi|186471723|ref|YP_001863041.1| alkylhydroperoxidase [Burkholderia phymatum STM815]
    MSKRLDYTRIAPAGVKALGGVYGYVMQSDLSPVLVDLVYLRVSQINNCAYCLDMHARDLLKKGVKVEKLALVQAWREAGH
    LFDDRERAALAWAESVTLVAQTGVPDEAYEAARAVFNERELVDLTIAISLMNTYNRMAISFRNTPQAVMEP

    >gi|186471927|ref|YP_001863245.1| methionine-R-sulfoxide reductase [Burkholderia phymatum STM815]
    MSAYEKTPEALARLTAEQRRVTQESGTERPFYNEFWDSKEAGLYVDVVSGEPLFTSLDKFDSGCGWPSFTKPLEDEHVVE
    LRDTTHGMIRTEVRSKHGDSHLGHVFPDGPRETGGLRY
    CINSASLRFIPVSQLEAEGYGQYRSLFEVANK

    >gi|186471948|ref|YP_001863266.1| OsmC family protein [Burkholderia phymatum STM815]
    MAQIEKVLYTGKVHTTGGREGAARSTDGRLDIKLSTPGGPGTGTNPEQLLGAGWSACFIGAMGGAARALNISLPADTSVD
    TEIDLGTTDGAYFIQARLNVSLPGLPRDVAQQVVDRAHQT
    CPYSKATRGNIDVTVTLV

    >gi|186474709|ref|YP_001863680.1| HesB/YadR/YfhF-family protein [Burkholderia phymatum STM815]
    MLPNLTVTPAAEKFMRRIVRFSGLPSGAGFRLLVNSGGCSGYDAGFSAVTGAQPGDEAMEINGLRLFLPAESRLLLDGVT
    IDFVDTPDRSGFAFMKDNQGPGVAASEGEPGVRRIEVGAIGHGRPLLPPPAS

    >gi|186474737|ref|YP_001863708.1| HesB/YadR/YfhF-family protein [Burkholderia phymatum STM815]
    MLPNLTVTPAAEKFMRRIVRFSGLPSGAGFRLLVNSGGCSGYDAGFSAVTGAQPGDEAMEINGLRLFLPAESRLLLDGVT
    IDFVDTPDRSGFAFMKDNQGPGVAASEGEPGVRRIEVGAIGHGRPLLPPPAS

    >gi|186471222|ref|YP_001862540.1| protein of unknown function DUF899 thioredoxin family protein [Burkholderia phymatum STM815]
    MTTHTVGTRDAWLKARLELLEAEKELTRRSDELARRRAALPWVRLDRQYRFETDKGSATLADLFAGRSQLIVYHFMFGPD
    YTAGCPS
    CSAIADGFDGMAVHLANHDVMLTAVSRAPLAKLQTYKERMGWRFPWASAHDSEFNFDFNVSYTEAQQRAGDVE
    YNFTRGGHAMDLTPAPQPVVEFAACCGTDASTYSRDRPGMSTFVLEDGVVYHAYSTYARGLDALWGMYQWLDRAPKGRNE
    TGIWWRRHDEYERRRG