Burkholderia mallei SAVP1 uid58387

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121597477|ref|YP_989903.1| pyridine nucleotide-disulphide oxidoreductase, class II, truncation [Burkholderia mallei SAVP1]
    MNFDVVIIGGSFAGQAAALQLARARRGVLLIDAKRPRNRFARTSHGFLGQDGHAPSAINATAGRQLAAYPTVQFDAGDAI
    DAAAVSDGFRVSLADGRQAQGRRLILATGVRDILPALPGLQERWGVSVLH
    CPYCHGYELERRPMGVLASSEQAVHQAMLV
    SDWGPTTLFTQGAFVPTREQSAMLSARGVTVEQTPVAALVGAAPALEAVCLADGRTAALCGLFIAPRTVPACDLPERLGC
    VFDDGPTGPYLSVDERQQTSVPGVFAAGGCRAADGECDVGRRRGRDRGSGRASFADLWCGRARLTDGGGDAGHTGAGGAR
    AGPHRRPAMPPCGRLFELPGEPQQDRVNRQFEAG

    >gi|121598146|ref|YP_990054.1| YeeE/YedE family protein [Burkholderia mallei SAVP1]
    MAVDFVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLLAGGRSDAGWRAAFLVGLIAAAVAANALDWFSMPAV
    DAGWARVIAGGVLVGIGTRYAGG
    CTSGHGVCGISRGAPRSIVATAVFMAAGIATVFVLRHVVGG

    >gi|121598119|ref|YP_990062.1| rhodanese-like domain-containing protein [Burkholderia mallei SAVP1]
    MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVATGHARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRN
    PRFVRELEAKTGKDAVVLLL
    CRSGNRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS

    >gi|121597569|ref|YP_990258.1| putative thiol:disulfide interchange protein DsbC [Burkholderia mallei SAVP1]
    MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEVNLGSQIVYSDASGDYVLLGE
    LVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STVKSKSIWCASDRVKSWQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
    VK

    >gi|121596847|ref|YP_990284.1| glutaredoxin-related protein [Burkholderia mallei SAVP1]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFTA

    >gi|121596505|ref|YP_990383.1| alkyl hydroperoxide reductase, subunit C [Burkholderia mallei SAVP1]
    MPIINSPIKPFKATAYHNGDFVQVSDETLKGKWSVVVFYPADFTFVCPTELGDLAERYAEFQKLGVEIYAVSTDTHFTHK
    AWHDTSDTIAKIKYPMIGDPTLAISRNFDVLIEEEGLALRGTFVINPQGEIKLCEIHDNGIGRDAGELLRKVQAAQYAAA
    HPGEVCPAKWTPGADTLTPSLDLIGKI

    >gi|121597100|ref|YP_990454.1| copper-translocating P-type ATPase [Burkholderia mallei SAVP1]
    MTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAVADLAAGTATVAAASAIDTARLVAALDAAGYRATVATA
    PAATGNADARHGRARDEDDDAAAAPHTAAVTLTIGGMT
    CGGCARRVEQALAAVRGVADAKVDLATTSAKASVARDVDSQT
    LVAAVEQAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQSFEFDIAGMT
    CASCVGRVEK
    ALAQVPGVVRATVNLATEKAAVDADADAHVDTARLIDAVKRAGYRASPVSDTASALAPSPEIAAARTAIELDIAGMT
    CAS
    CVGRVEKALAQVPGVARATVNLATEKATVDADADAHVDTARLIDAVKRAGYRASPAIAACAPASRATATADAAAARPASP
    SADDRKLAEARRERALVIASAVLTTPLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMDLL
    VALGTSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPDRARIVEHGVERDVPL
    AQVRVGTVVRVLPGERVPVDGRIEAGVTHVDESLITGESLPVPKEPGERVTAGSINGEGALTVATTAIGAETTLARIIRL
    VESAQAEKAPIQRLVDRVSAVFVPAIVAIAFATFAGWLVAGAGVETAILNAVAVLVIACPCALGLATPAAIMAGTGVAAR
    HGVLIKDAQALELAQRARIVAFDKTGTLTQGRPTVTAFDAIGIPRGDALALAAAVQRASAHPLARAVVAAFDADADARRS
    SLAAAHADTPRAVAGRGVEARVDARLLALGSTRWRDELGIAVPDGVARRAAALEAAGNTVSWLMRADAPREALALVAFGD
    TVKPNARRAIERLAARGIRSALVTGDNRGSATAVAASLGIDEVHAQVLPDDKARVVAQLKATAGDGAVAMVGDGINDAPA
    LAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAVDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAAMA
    FSSVSVVTNALLLRRWKGDAR

    >gi|121597939|ref|YP_990632.1| dihydrolipoamide dehydrogenase [Burkholderia mallei SAVP1]
    MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAGEFDKVRGFAGDSPLGIRTQA
    PAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDARVVDGKTVDVDTGGGARVRIQ
    CEHLLLAAGSEPVELPAMPF
    GGNVISSTGALSPGRLPKRLVVVGAGYIGLELGIAYRKLGVEVSVVEARERILPIYDAELTKPVAASLKRLGVRVLLGHK
    VLGLNARGDAVCVQDDAHAQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKVDDMCRTSMRNVWAIGDLTGEPML
    AHRAMAQGEMVAEIVAGKKRHFMPAAIAAICFTDPEVVSAGLAPDEAERTFGACVSASFPFAANGRALTLESADGFVRVV
    ARRDDHLIVGWQAVGAGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI

    >gi|121598038|ref|YP_990645.1| pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia mallei SAVP1]
    MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGV
    RAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEI
    AATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
    VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVS
    IFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDP
    NYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
    YESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETG
    EPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVE
    VMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
    YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA

    >gi|121597829|ref|YP_990681.1| putative lipoprotein [Burkholderia mallei SAVP1]
    MKTAIRKLTASLLVAAAAACFAADAPHAPEHLPPGIAWRQGDVDAAFAEAKRTNKPLFLYWGAVWCPSCNQVKSTIFSQQ
    AFKSRSSFFVPVYLDGDTENAQKIGDRFKVRGYPTMILFRPDGTELTRLPGEVDLDRYMQALSIGLNASHPFKRTLAAAL
    KDGARVTPDEWRVLADYSWDTDGDLPVPGERVAATLQALARHARADHANAQALRLDLKAAVSAAAGDPPQQGDVDKAAAA
    AAVRDALRDPKRARADYDVLVAAPAEVVAYLAGGDAAARALLAKQYDAALARLSTDASLAAIDRTMALHGRVRVARLDAR
    PGAPLPPALADAVRRQTASAVTESTNVYGRQAVVSEAADTLTDAGQFDAADALLKAELVRSPTPYYFMSGLAANAKARGD
    RAAALDWYRKAYEAASGSATRLRWGAAYFANAVDLAPDDAAQIRRIANDVLTQASQTRNAFYGANRRALTRVVTQLARWR
    QRGAHDAAAQAVVKQFEGVCGKLPVGDPQVGTCEGLLKTAKA

    >gi|121597559|ref|YP_990741.1| arsenate reductase [Burkholderia mallei SAVP1]
    MITIYHNPRCSKSRETLALVETLNPTGEAINVVEYLKQPLTAAQLKVLHRQLGRPVRDMIRDNEAPYKDLNLADAALSDT
    QLYDAIAEHPILLQRPIVVHGDKAAIGRPPEAVRSLFE

    >gi|121596902|ref|YP_991019.1| hypothetical protein BMASAVP1_1423 [Burkholderia mallei SAVP1]
    MPLIHATAEMAPDAPNYVVELEAGKHRLQGDENEHEGGGNVGPAPYELVLSGLAACTVATLRMYMQRKAWPAARLLARAE
    LHVDREGAQYVRRTIVVDGALDGAQRTRLAEIAEKTPVTLFVKRGTRIETTLK

    >gi|121598067|ref|YP_991078.1| organic hydroperoxide resistance protein [Burkholderia mallei SAVP1]
    MNILYKTAATSTGGRDGRATSHDQKLDMKLSAPRELGGAGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTTVT
    AEVGIGPNEEGGFALDVELRVALPGLDAAAAKTLVDRAHHV
    CPYSNATRNNVAVRLVVA

    >gi|121597081|ref|YP_991102.1| rhodanese domain-containing protein [Burkholderia mallei SAVP1]
    MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTDLGEQAYAAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDA
    LVDTLKAHGLRQNQQIVAYDAQGGMYAARLWWLLRWLGHDSVAVLDGGLQAWQSEGHAVSQDTPPKSMGDFRAGAPLATV
    VDAQTVLANLATKDRLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTADGRFKSGHELREAFSPLLGATEPKKV
    ILQ
    CGSGVTACHNALAMEIAGLHDPALYAGSWSEWSADPSRPVATGANP

    >gi|121597952|ref|YP_991135.1| dedA family protein [Burkholderia mallei SAVP1]
    MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPDALGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRA
    LKTLCKLSLSRDSCVKKTERFFGRWGVRVLAVARFIPGLSLISVPMAGALGTRYRVFVGYDGLGALLWAGCGVAIGFAFA
    KQIDWLFAGANQLGRAVLVVIVALLAVYTAVRWMRRRALIRQLANARIDVDELERLLRAEPAPVVFDARSPEHRKLDPYA
    IPGAQFADERDLRDIVAHYPATQKFVIYCS
    CPNEVSAALMAQRLKQAGFADALALRGGLDAWRDTGRQLIELAPQPPSEA
    PVLAAAPKTA

    >gi|121597660|ref|YP_991165.1| ArsR family transcriptional regulator [Burkholderia mallei SAVP1]
    MSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERSVEDLTALSGMSFANTSRHLQILRRARLVDTERRGKNVVYRL
    AGDSEVVGLMKALGRLGERNVAEVNRVLGDYFHARDSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGALNIPLA
    ALEARLSELPADTEIVAY
    CRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGFVVETEPAN

    >gi|121600735|ref|YP_991530.1| glutaredoxin 3 [Burkholderia mallei SAVP1]
    MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLK
    PLLEAA

    >gi|121599615|ref|YP_991531.1| rhodanese-like domain-containing protein [Burkholderia mallei SAVP1]
    MTFFTDYTNLALIAILVVSGSLLAWPALRRGGGGLSAAEATQLINRRNALVVDLRPAAEYGAGHLPSARSVEFGELQAKA
    GQLAKNKATPVLLV
    CQNGQQSQKARKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK

    >gi|121599937|ref|YP_991534.1| HesA/MoeB/ThiF family protein [Burkholderia mallei SAVP1]
    MNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAAAGVGTITLVDADTVDLTNLQRQILHATDSVG
    RKKVESGRDALARLNPDVKVNAVAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVAHRVPLVSGAALRFDGQIST
    FDFREPGSPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGATLVGRLMMLDSLRMEWNTMKIARQ
    PDCPVCGAGGAH

    >gi|121599489|ref|YP_991551.1| hypothetical protein BMASAVP1_A0200 [Burkholderia mallei SAVP1]
    MSPAPAPTSRRAGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEATFTLLSGQKLSTAADLKGKVYLVNFWATSCATCMQE
    MPQMVDTYNRFKGRGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGA
    PQFAELDQLLQKALDTSA

    >gi|121599685|ref|YP_991606.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei SAVP1]
    MNAVTESAATTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLNKNGVVLLVD
    AMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|121599058|ref|YP_991687.1| OsmC/Ohr family protein [Burkholderia mallei SAVP1]
    MPNHNRIKQRWSSRMECKVSWMGQDGMAFAAQTGSGHLVTMDGAPEGGGNNLAPRPMEMVLVGTGGCTAYDVVLILKKSR
    QEVIGCSVTLQAERASEDPKVFTKIHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELSHSFEIVAA

    >gi|121601610|ref|YP_991770.1| putative thioredoxin family protein [Burkholderia mallei SAVP1]
    MNSKGIFAGIVVAAVAVAGGLAAGHWMRGNPASGPQAGTPAAPPAAGNPVDTLWAASYPDVDGKPQRLAAFKGQKLVVNF
    WASW
    CGPCVEEMPELVKLSREYEKKGVRFVGIGVDSDQNVKNFLKKVPVDYPIVVSGYAGADLARHFGNTAGALPFTVVI
    DETGKIRETKLGQIRPDELKRTLDTL

    >gi|121600441|ref|YP_991776.1| thiol peroxidase [Burkholderia mallei SAVP1]
    MSKVTLGGNPIDIAGTFPTVGSPAPDFKLVGKDLADVSLATFAGKRKVLNIVPSLDTPTCAASTRKFNEAASKLDNTVVV
    VVSADLPFAATRFCTTEGLANVITASTFRGGRAFADAYGVNVTSGPLDGLAARAVIVIDENDKVTYTELVGEIKNEPNYD
    AALAALK

    >gi|121598876|ref|YP_991814.1| AhpC/TSA family protein [Burkholderia mallei SAVP1]
    MTDETADDRPRRFATPGRVSRPLRMREAGLGRVVCRERPYRYEGPGMIQVGDTLPDAQLFEYLDDARAGCTLGPNAFGVR
    EQTAGKRVVIFGLPGAFTPT
    CSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTH
    ALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVEAPGKFEVSDAASVLAGLTR

    >gi|121600345|ref|YP_992001.1| peptide methionine sulfoxide reductase [Burkholderia mallei SAVP1]
    MAGREQGGHREIRLVSDDFSGNRVRLRRAAAPRACREWPAPHFARRAARCGAAAPPGEEGAPRRPADAARARGEAGRAAH
    DGERRAPPHGERNERNERKETDMSEATSEVATLGGG
    CFWCQEAVFLDVDGVTAVESGYAGGHTRNPGYRDVCDGDTGHAE
    VVSVSFDPARIGYREILEIFFATHDPTQLNRQGNDVGTQYRSVIFTHSDAQRDAALELIRTLERDKLYDDPIVTQVEPLN
    GNYWPAEAYHQNYYARNPGQGYCAVVIGPKLAKFRQKFAHRLKSRGA

    >gi|121600692|ref|YP_992007.1| thioredoxin domain-containing protein [Burkholderia mallei SAVP1]
    MKKRPRSPIVHTSNIDEDAMDTTLATFERDVIEASLAAPVLVDFWAPWCGPCKTLGPLLEKLEQEYEGRWKLVKVNVDEN
    QELAAHFQTRSIPHVIAFAGGQPVDQFVGVLPEGQLRTFLDRLVPAPDEAERYAAQTALAEERIDDALSHLENALALNPG
    YDDARLDLVELLLALNRIDDARAEAARLSPQTTGGADARYQAIKTRFDALDATADLPPTDALEARIASHPADLDARFDLA
    QSLIARRAYEGALEQLLEIVLRDRTFGDDVGRKTMISVFELAADQPELVSAWRRKLSAALN

    >gi|121598630|ref|YP_992014.1| methylated-DNA-protein-cysteine methyltransferase [Burkholderia mallei SAVP1]
    MFNAVIDAPFGKVGIRTDASVVREIVYLPESIKRVAPGTPLAKQAARQIELYFERASARFDLPLAEVGTPFQHRVWHAIC
    AIPPGVVLTYGQIAKQIGSAPRAVGQACGANYFPLVIP
    CHRVVASGGLGGFANHDDEGYFLKVKRWLLAHEGVRY

    >gi|121600277|ref|YP_992134.1| thioredoxin-disulfide reductase [Burkholderia mallei SAVP1]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADADGVQGPELMQRFLAHAQRFNTEI
    VFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYLGLQSEEAFMGRGVSA
    CATCDGFFYRGQNVAVVGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILVDRLLEKEKEGAVEIKWDHVLDEVTGDDSGVSGVRIKHVTTGATEDVAVQGLF
    IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDHK


    >gi|121601598|ref|YP_992184.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei SAVP1]
    MSLRLGDIAPDFEQDSSLGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKGEFEKRNVKVIALSVDSVESHKGW
    IDDINETQATSVGFPIIADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DHYKVATPGNWKDGDDVVIVPSLQDPDELKQRFPKGFKAVRPYLRLTPQPNK

    >gi|121598763|ref|YP_992397.1| carboxymuconolactone decarboxylase family protein [Burkholderia mallei SAVP1]
    MAHAPRLPYPKLASKPFNALLHLSETVWGGSLGKPLVDLVFLRVSQINGCAYCIDMHWRDLVKLGVNERHLNAVAGWREA
    PFFDARERAALQWAESVARIPHTDPSDEAFAQLQAHFSDAEIAELGFAIATINAWNLLNVSFRNPIPETV

    >gi|121599298|ref|YP_992826.1| dihydrolipoamide dehydrogenase [Burkholderia mallei SAVP1]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENAQHHLADHGIS
    VDGVKMDVAKMLARKDGIVEKMTGGIEFLFKKNKITWLKGHGKFTGKSDAGVQIEVSGEGETQVVTAKNVIIATGSKARH
    LSNVPVDNKIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIDGVKTGANGVSIAYTDKDGNAKTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|121601527|ref|YP_993172.1| thioredoxin [Burkholderia mallei SAVP1]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|121598403|ref|YP_993204.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei SAVP1]
    MSVEVDRQVPDFTAPATGGEFSLSGIKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHENFK
    AKLELPFLLISDPDETLCALFGVMKLKKMYGKEVRGIERSTFLIDGAGMLRHAWRGVKVPGHVDDVLSAVQAL

    >gi|121601004|ref|YP_993250.1| hypothetical protein BMASAVP1_A1931 [Burkholderia mallei SAVP1]
    MGSNMSFSRSEAAPAAPLPDLAATLAAPRDDAFQQLGAAFVTRLPAAPLPAPYVVGFSDDAARMLGLEPALRDAPGFAEL
    FCGNPTRDWPQASLPYASVYSGHQFGVWAGQLGDGRALTIGELAHDGRRYELQLKGAGRTPYSRMGDGRAVLRSSIREFL
    CSEAMHHLGIPTTRALAVIGSDQPVVREEIETSAVVTRVAQSFVRFGHFEHFFANDRPEQLRALADHVIERFYPACRDAD
    DPYLALLAEATRRTAELVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFIDAFDAKHVCNHSDTQGRYAYRMQPRIAHW
    NCFCLAQALLPLIGLHRDAPSEDARAERAVEDAHAVLGRFPEQFGPALERAIRAKLGLALEREGDAALANQLLEIMDASH
    ADFTLTFRHLARVSKHDARGDAPVRDLFIDRDAFDRWANLYRARLSEEARDDASRAAAMNRVNPKYVLRNHLAETAIRRA
    KEKDFSEVERLAAVLRRPFDEQPEHDAYAALPPDWASTLEVS
    CSS

    >gi|121600241|ref|YP_993251.1| methionine-R-sulfoxide reductase [Burkholderia mallei SAVP1]
    MSGDRDDPRYPYPKDDAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCGTALFESGAKFHSGCGWPSYFK
    PIDGEVIDEKMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEAKPERK

    >gi|121600102|ref|YP_993298.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei SAVP1]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEILR
    ILDGLQTDELCPCNRAIGGATL

    >gi|121599662|ref|YP_993386.1| hypothetical protein BMASAVP1_A2070 [Burkholderia mallei SAVP1]
    MAGAKAAAGTVVYGIPNCDTVKKARTWLESHGVEFAFHDFKKAGVSAPLVKGWLADVPLDALVNRRGTTWRALTDEQKAA
    AESEAGAIALMIDKPSVIKRPVVVVDGRVKALGFSADEYAGLFA

    >gi|121601353|ref|YP_993390.1| glutathione peroxidase [Burkholderia mallei SAVP1]
    MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVLGFPCNQFGKQEPGDASQIGA
    FCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGLKAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL

    >gi|121600391|ref|YP_993527.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei SAVP1]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDELTPEDQMFESHGVKVFVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|121598428|ref|YP_993540.1| pyruvate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Burkholderia mallei SAVP1]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEIKIKAGDKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKPAAAAPAPAAAPAPAPQAGSSSGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTALVVEEAQALASHGITFGKPQVELDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPY
    HMEVQGENGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAQAKEDGIYVTFEGEKAPAQAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|121600851|ref|YP_993773.1| hypothetical protein BMASAVP1_A2469 [Burkholderia mallei SAVP1]
    MSAAVRFTLYGRGWCHLCDEMRDALAPVAAECSASVDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDEARVRGALA
    RRGA

    >gi|121600940|ref|YP_993904.1| disulfide bond formation protein B [Burkholderia mallei SAVP1]
    MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFIGAGMASGAGVAVTEALIVLS
    AAAGVGTAARHLYVQLNPGFS
    CGFDALQPVVDSLPPARWLPGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVS
    LLRHRGRLR

    >gi|121601187|ref|YP_994104.1| hypothetical protein BMASAVP1_A2809 [Burkholderia mallei SAVP1]
    MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDRLADTHPGACFAWIDVETHADRLDELDVENFPTLLI
    EDANAVRFFGTVLPHAAIVERMLADLTALPGAPHAPKLRNLFD

    >gi|121601109|ref|YP_994130.1| ADA regulatory protein [Burkholderia mallei SAVP1]
    MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRE
    LDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPER
    IAPFIAQIDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA

    >gi|121599541|ref|YP_994147.1| 4-carboxymuconolactone decarboxylase family protein [Burkholderia mallei SAVP1]
    MALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDDCIGFHVQTLVKLGTT
    REEFEDLLATAVYMGGGPSMMYAA

    >gi|121600348|ref|YP_994324.1| glutathione-disulfide reductase [Burkholderia mallei SAVP1]
    MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLRGCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSW
    PTLIEAKDREIARLSGIYVDLLNKSGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREAL
    ELPELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGVAIHTRATIEAIERGADGG
    LTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDANGAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLL
    AANLFGGKRIAADHRYVPSAVFSQPEIATVGLTEAQARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVVG
    AHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA

    >gi|121601279|ref|YP_994390.1| thiol:disulfide interchange protein DsbA [Burkholderia mallei SAVP1]
    MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIA
    FKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVK
    QSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL

    >gi|121601617|ref|YP_994427.1| putative thiol:disulfide interchange protein DsbD [Burkholderia mallei SAVP1]
    MFNRIPRHAQSRFRFLIAVVAMLGVLFGTSLAARAADDFLDPAVAFKFSASEAPGQVDVHFKIADGYYMYRERFAFAVKS
    GSATLGEPQLPAGHVKFDPTFQKNVETYRGDLTIHLPIKQASGPFELAVTSQGCADEGICYPPAEHVARIEGAALGAAGT
    APAAAGAGADTSAADGGSWYERVTSADYARSLLEGHGFLTIVALYFVAGMVLSLLPCSYPMIPILSAIIVGEGARATRAR
    AFALSLTYVMGMALVYTALGVAAALVGQSLGAWLQNPWVLGAFALLLTVFALLLIGGVDITLPQRWQNGAAQTSGPRKGG
    RFAAVATMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFSMGIGLGVPLLVIGIGAGTLLPRAGAWMDGVKVFF
    GVLLLAAALWIVWPVLNAASQLGLGALWLLIAAAALGLFTPHSGSSSVWRRLGRGLGAALAIWAATLLVGLAAGSTDPLR
    PLAVLAARAAPNNGPAGAGAGAHEGPAFAPVRSIAELDEIVKTSTRPVMLDFYADW
    CVSCKEMEHLTFTDARVGARLSQM
    HLVRADVTANSPDDQALLKRFGLFGPPGIIVFDANGQERGRVVGYQSADRFLRSLDRMSLPAAWSAS

    >gi|121601047|ref|YP_994542.1| stringent starvation protein A [Burkholderia mallei SAVP1]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|121599986|ref|YP_991510.1| SCO1/SenC family protein [Burkholderia mallei SAVP1]
    MLKTLFARRRAQRGWLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHC
    PDV
    CPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQLKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDPNGKLRLFVRDGQGPGPWVHDLKLLLD

    >gi|121600689|ref|YP_992383.1| rhodanese superfamily protein [Burkholderia mallei SAVP1]
    MTTVNLAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLFEGKFADLPFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDQGHDDAGRPVVMLDTRNAFEVDVGTFDRALDYRI
    DKFSEFPAVIEANRADLEGKTIVSF
    CTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLAPTADVTCFACRAVVPADAQQSPLYVPGKCCPACHPGDSGTPGRRAEPGAEPARAV