Acidovorax ebreus TPSY uid59233

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222109232|ref|YP_002551496.1| OsmC family protein [Acidovorax ebreus TPSY]
    MSEKKASVHWEGGGKAGQGQISTETEALQKYPYGFASRFGDDRKGTNPEEILGAAHAACFTMAFSFAADKAGFATERVDT
    TASVRLTQQGEGFLIDRIALTLKAKVPGMDEATFQKLAADAKAN
    CPLSKALAAVPEITLSATLVQ

    >gi|222109261|ref|YP_002551525.1| Heavy metal transport/detoxification protein [Acidovorax ebreus TPSY]
    MQYTFQVQGMTCGHCERAVVHAVRQVDTDALVKVDLATGQVIVESDKSREALANAIQEEGYKVAA

    >gi|222109262|ref|YP_002551526.1| heavy metal translocating P-type ATPase [Acidovorax ebreus TPSY]
    MTSASLSPAATGDAPAGTLDLGIAGMTCASCVGRVERALRKVPGVQDATVNLATERAHIVFDAASGGGMEALARRAVRNA
    GYEPRSVEEQEAGEEGAQSPWAGFTPVAVGLLLSAPLVLPMLGDLFGLHWMLPAWVQFILATPVQFILGARFYKAGWHAA
    KALTGNMDLLVAIGTSAGYGLSLWLWATAESTHGAGHTPHLYFEASAVVITLVLLGKWLEARAKRQTTAAIRALHALRPE
    VAHLLGRDGEVDVPIAEVMAGDRLVVRPGERIPVDGTVVEGHTQVDESMLTGEPLPVARSADGPEGGALTGGSINGDGRI
    VMQVTAVGSETVLARIIRLVEDAQAAKAPIQRLVDKVSAVFVPVVLAIAIVTLLGWLWTGAGVEAALIHAVAVLVIACPC
    ALGLATPAAIMAGTGVAARHGILIKDAEALETAHRVQTVAFDKTGTLTVGRPRLTAFHVEPGVDEAALLSAVAAVQSGSE
    HPLARAVVSAAQERGLPAPAPDGVRAVPGRGTEGEVAARSYLVGSLRWMQELGVDLGPLADRAATLQAEGATVSAVAERV
    AQDPSGARPPEAASAPLGGSEDTIVPSAGAHYVLRALLAFGDEPKPGAREALAHLRTQGVRCVMISGDNRGAAEAMARRL
    GLQPEAGEVMAEVLPGDKAAAVNALKAQGHVVAMVGDGVNDAPALAAADVGMAMGNGTDVAMHAAGITLMRGDPQLVAAA
    LDISRRTVAKIRQNLFWAFAYNVAGIPLAALGYLSPVVAGAAMALSSVSVMTNALLLKRWRG

    >gi|222109412|ref|YP_002551676.1| Glutathione peroxidase [Acidovorax ebreus TPSY]
    MTTAYDFDATRIDGAPQPLSDFRGQVLLIVNTASACGFTPQFTGLQALHERYGPRGLVVLGFPCNQFGHQDPGSNDAIAG
    FCQRNYGVQFPMMSKIDVNGSDAHPLYRWLTGEAPGVLGTKAIKWNFTKFLVGRDGQVIRRYAPQEAPEKLTVDIEAALA
    A

    >gi|222109418|ref|YP_002551682.1| Glutathione S-transferase domain protein [Acidovorax ebreus TPSY]
    MTSLTLYFTPGTCAQAVRIALEEAQAPYTLVRVDFASQQQRSPEYLAVNPKGRVPALVTEHGTLTETPALLAYVAQRFAD
    ARLAPADPFGFARMQEFHSYLASTVHIAHAHRPRASRWADEPEAQAAMQRKVPANMTECFTLIERHYLGDGPWVLGEQYS
    VADGYLFTVASWLKSDGVDIAQFPKVHAHSQRMAQRPAVQRALA

    >gi|222109432|ref|YP_002551696.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidovorax ebreus TPSY]
    MTAAAPFFAPAPPLQVAHWFNTPEPLTLDSLRGRVVVLHAFQMLCPGCVEHGIPQARRVHEAFAQDQLVVIGLHTVFEHH
    AVQGTPEALQAFIHEYRLRFPIGLDQPDTPRSIPRTMQSLSLSGTPSLVVLDPQGRVRLHHFGHLDDLRLGALLGRLLAE
    PTPAAPATVPATGCDDGGCPLPDQPRP

    >gi|222109503|ref|YP_002551767.1| Redoxin domain protein [Acidovorax ebreus TPSY]
    MIQVGDTLPAITLMEYSEVEGNGCSLGPNPVDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAGDLKAAGVDEIWC
    LSVNDAFVMGAWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVVALNVEAPGKFEVSDAA
    TLLGQAKG

    >gi|222109507|ref|YP_002551771.1| Redoxin domain protein [Acidovorax ebreus TPSY]
    MQIKKWLAAGALVAGAAVGAVVVLGSGTSQAPQSTFVLLDGSQQTTADLKGKVALVNFWATSCTTCVAEMPEIVATYDKY
    KGQGFETLAVAMSYDPPSYVVNFTETRKLPFKVAIDNTGAVAKAWGDVKLTPTTYIVNKRGEIVKSYIGAPDFEELHKLI
    ERLLAEA

    >gi|222109554|ref|YP_002551818.1| DSBA oxidoreductase [Acidovorax ebreus TPSY]
    MKRREFSLTVASAATALSLPLAAPALAQGRQFKEGKDYVKLGKPVATEAPAGKIEVIEFFWYSCPHCNTFEPSLEAWIKS
    APKDLHIRRVPVAFNASFVPQQKLYYALEGMGKLPELHAKVFRAVHVERLPLNKDELIFDWIGKQGVDVAKFKEVYNSFT
    VSNQVRKASQLQDGYQVEGVPSMGVAGRYYTDGTMAGNMQSVLQVVEHLVGVARKG

    >gi|222109692|ref|YP_002551956.1| OsmC family protein [Acidovorax ebreus TPSY]
    MTTLDKVLYTARAHTTGGRDGASRSDDGRLQVQLSSPGGSGTGTNPEQLFAAGYSACFIGAIKAVAAKQKLTLPQDLAID
    AEVDLGTIPNAYGIAARLKVHLPGMDRAQAQQLVNDAHQV
    CPYSNATRGNIDVTLTLA

    >gi|222109736|ref|YP_002552000.1| thioredoxin [Acidovorax ebreus TPSY]
    MSSPEALHVVCPHCHTTNRVQAAQLGSAPDCGSCHRPLFTGEPLALDAASFDRHVARSHLPVVVDFWAPWCGPCRQMAPA
    FAQAARELEPRVRLAKLDTEAHPAIAARYGIRSIPTMILFRGGQEAARISGALGAADIARWVQSV

    >gi|222109824|ref|YP_002552088.1| iron-sulfur cluster assembly accessory protein [Acidovorax ebreus TPSY]
    MSAVAENTTTEMPAPILFTDSAAAKVAELIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLQGAQFVIKNPNAASTCGCGSSFSVEDH

    >gi|222109849|ref|YP_002552113.1| DSBA oxidoreductase [Acidovorax ebreus TPSY]
    MNQPVSLKIDFVSDVSCPWCAIGLHALEQAAKRLDGEVALDLHFQPFELNPQMGLEGQDIGEHLQQKYGATPEQSQQNRE
    AIAARGAQLGFTFNMDRRGRIYNTFDAHRLLHWLEEEGTPEQRGALKHALFTAYFTQGENPGDHGVLLRLVAQLGLDEAR
    ARAVLASQEYAEAVREREAFYQGHGIHSVPAVIINDRHLIQGGQPVEVFEQALRQIAQQA

    >gi|222109970|ref|YP_002552234.1| Glutathione S-transferase domain protein [Acidovorax ebreus TPSY]
    MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVDRARVRLFLLNFEKELFVHVNALESRATKGNEKALEKARTHIRDRLTQLAPVFLKNKYMLGEGFSMLDVAIAPLL
    WRLDYYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|222109993|ref|YP_002552257.1| glutaredoxin-like protein [Acidovorax ebreus TPSY]
    MSDVQQRIDQLVKTNDILLFMKGNASFPMCGFSGRAVQILKACGVDPKNIATVNVLDDQEIRQGIKDYSHWPTIPQLYVK
    GEFIGGSDIMMEMYESGELQQVLGTGDAA

    >gi|222110165|ref|YP_002552429.1| 3-mercaptopyruvate sulfurtransferase [Acidovorax ebreus TPSY]
    MHYTTLISVPELQSLLHSGQPLMVFDCSFDLTQPTLGASQYREAHIPGAFHADLDKHLSARHGAPGAGGTVVASAADEPA
    SGGRHPLPNRERFATWLSDIGFANDMQAVVYDRNGANYCGRLWWMLKWAGHDAVAVLDGGLQAWQAAGGAVASGDEPARF
    QSHFRLQAPLRRLVSAQEVLAQLGQPGQTVVDARATPRYRGEVEPLDPVAGHIPGALNRPFGLNLGTDGHFKSPEQLRAE
    FTNLLDGRDPATVVHQ
    CGSGVSALPNLLAMEIAGLGPTALFAGSWSEWCSDPGRPVERG

    >gi|222110212|ref|YP_002552476.1| heavy metal translocating P-type ATPase [Acidovorax ebreus TPSY]
    MSNPDADPWASPLSTAAPDEVALLDDPQEWSAFGKPCTSTPAGADAQAGPWESHVVLDGMHCAACALTIEEALRRVPGVA
    EADVSAATRRARVVWDPRRVRPSQWMGAVQKAGYRALPALDALAREQRQRENRKALWRWLVAGFCMMQVMMYAWPAYQAM
    PGDLTMEMEQLLRWASWVISLPVVLFACGPFFSSALRDIRQRRVSMDLPVALGMLITFVVSMAGTFDPTGPFGREVYYDS
    LTMFVFFLLTGRWLELRLRDRTAGALEAVMNRLPDSVERRAEDGSFTRVATRRLQAGDVVRVLPGEAFPADGRILSGGTQ
    ADEALLTGESTPVDRPEGSRVTAGSYNLRAPVTVEVLALGSETRFGQIVALMESASLQKPRLAQLADRVARPFLVAVLLA
    AGLAAVWWWPSDPSHALMVAVAVLIVTCPCALSLATPVAMLTAAGTLARRGVLVRNLQGLEALAAVDTVVFDKTGTLTRD
    GLALHAVHVAPGAGWGEGEALALASALAAHSLHPASRALASAAQSAAAAPAGWTVHAVQELPGAGLVARASSPSHAQETI
    LRLGSAAHARVPAVGGDAGPQVVLSMECEGAAVEIARFVLSEQLRPEVATAVRGLRAEGVAVELLSGDRAESVQRVAAQA
    GIGQARGDCTPQDKLAHLQTLQAQGHHVAMVGDGLNDGPVLAGAHVSFAFGRAVPLAQSRSDFVVMGENLALVAQALWLA
    RRTLRIVRQNLWWAAAYNALCVPLAIAGYMPAWLAGLGMALSSLLVVLNAARLARLPDPISHESSDDCAGAPRAVSTPLE
    VV

    >gi|222110233|ref|YP_002552497.1| methylated-DNA/protein-cysteine methyltransferase [Acidovorax ebreus TPSY]
    MLYAQTVPTPLGEMLAVASDRGLCLLEFVGQPGVERELAQVQAARGEVLREKGNAVTVLLASELAEYFGRRRRVFGVPLD
    LVGTPFQIAAWQALLAIPYGETRSYAQQARTIDQPTATRAVAAANGQNKVSIVVP
    CHRVIGSNGSLTGFGGGLPRKRALL
    ALEDTSAQRDWLNETP

    >gi|222110347|ref|YP_002552611.1| heavy metal translocating P-type ATPase [Acidovorax ebreus TPSY]
    MSNFNYGKHTMSMATTSSAGAQAAAISLPIEGMTCASCVGRVEAALAKVEGVASVSVNLATERADIRLNRPVDRMALIQA
    IEKVGYDVPQGTIELAIGGMT
    CASCVGRVEKALKAVPGVTEAVVNLATERATVRGVASVQDLIAAVDKVGYEASPVDTGM
    QADEEAAEKKDAERAELKRDLTLAAVLALPVFVLEMGSHMIPGMHEWVASTIGIQQSWYLQFVLTLLVLAIPGWRFYEKG
    FPALFRLGPDMNSLVAVGTAAAFGYSMVATFAPSLLPAGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLIGLQ
    AKEAHVLRDGRIVDIPINDVAQGDIVEVRPGERVPVDGEVTEGRSFVDESMITGEPIPVEKAEGSTVVGGTVNQKGALTL
    RATAVGGQTMLAQIIRMVEQAQGSKLPIQAVVDKVTLWFVPAVMLAAVLTFLVWLVFGPSPALSFALVNAVAVLIIACPC
    AMGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLEIADGFDRNQVLAKVAAVESRSE
    HPIARAIVESAVEGGIALPTMTDFDSVTGMGVRATVDGARVEVGADRFMRELGLDVGSFARTAERLGNEGKSPLYAAIDG
    RLAAIIAVADPIKSSTPAAIAALHQLGLKVAMITGDNARTAQAIAKQLGIDEVVAEVLPEGKVEAVRRLKASHGQIAYVG
    DGINDAPALAEADVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIGNIRQNLFWAFGYNTALIPVAAGVLYPA
    YGVLLSPIFAAGAMALSSVFVLGNALRLRRFQPPLAADTAH

    >gi|222110349|ref|YP_002552613.1| dihydrolipoamide dehydrogenase [Acidovorax ebreus TPSY]
    MEMHFDVIVIGAGPGGYIAAIRAAQLGMKVACVDAWKNKDGKPAPGGTCNNIGCIPSKALLQSSENFEQAKHHFGTHGIS
    TGDLRMDVTTMLERKNQVVKSSNEGILYLFRKNKVQFFNGLASFTRTVDGGFEVSVAADEAVTLVGKQIIVATGSNVRPL
    PNLPFDERVVLSNDGALDIAAVPDRLAVIGAGVIGLELGSVWRRLGADVTILEGLPSFLPIVDQAIAKEAKKAFDKQGLK
    IELGAKVREVNATEAGVTIHYTDSQGQTQSLQADKVIVAIGRVPNTEGLNPAAVGLQLDERGAVLVDDECRTSVPGIWAI
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVDFNTIPNVIYTSPEIAWVGRTEQQLKEQGTAYRIGSFPFMANGRARALG
    DTPGLVKVIADPATDEILGVHVVGPQASELVAEAVIAMAFKASSEDIARICFAHPTLSETFKEASLAVDKRALNF

    >gi|222110360|ref|YP_002552624.1| heavy metal translocating P-type ATPase [Acidovorax ebreus TPSY]
    MSLETLDGTGAQDEQLGFRVEGMDCASCVGKIETALGRIDGVSNVQVNFTNETLTLTRSTSSRNTARDIAKKIRSLGFDV
    QALPASEMSAAPAPCHAAHAHDHAGCGGHHDHGHAHDHGHDHSHGKACGDDHGHGHAHGHAHAHDHGHDHGACSGHDHAP
    ASASRGAPSTPPNVSMRVEGMD
    CASCVGKIETALARMDGVSDARINFTAETLELTLASGGPTQLGHIEKTIKSLGFGVSD
    VRRHDGSAPAAPAAASTARHQRWWQTKKGKHVLGLGGLMGSAYAIAQFVPGYAEWIFAAAVIAGVLPFARKAFALAVSGS
    PFSIETLMVVASLGALVIGEAEEAAAVVFLFAIGELLESVAAGRARAGIKALASLVPKTAVLLDAAGGQREVPAASLRVS
    DRVLVRPGDRVPADGKILRGESSLDESPITGESVPRQKAIGADVFAGSINVDGVLEVQVEKTASDNTISRIIQLVEQAQS
    SKAPTARFIEKFSRYYTPAVMAIAALIVVVPPLAMGGDWGTWLYRGLALLLIACPCALVLSTPAAIASGLAVATRRGLLI
    KGGNALETIGRVRAIAFDKTGTLTEGKPRITEVLPFGLFKHQQVLALAAAVESGSNHPLAKAIVAHAKSLDVAIPQATGA
    SAIAGKAVRATVNGSALAVGSPAHAEQTATLTAAHRREIDKLEDGGKTVVVLFDEASKNVLGLLALRDEPRRDAREGVAQ
    LNAMGVRSVMLTGDNRRTAQAIAGKLGIEWEAELLPQDKLRLVNEMKRDAKVAMVGDGINDAPALATADVGIAMGGGTDV
    ALETADAALLKSRVTDVAHLVALSRATMANIHQNVVFAIGLKGLFLVTTVLGITGLWVAVLADTGATALVTLNALRLLRF
    KGAPEANHGDDAGRPTTLSVPSAR

    >gi|222110367|ref|YP_002552631.1| mercuric reductase [Acidovorax ebreus TPSY]
    MNTTTAASAQQPSVIYDLVTIGSGSAARAAANEARRLDKTVAMIEQGLAGGTCLNVGCVPSKTLLAAASARMSAAHGKFP
    GIATSAGPVDLSLLVRDKDQMIGHFRQSFHVQAPKDAGIAVFRGKATFVASDEPDIVALVVADSDGNTNLVYAKQVLIAS
    GAAPFIPSIPGLSEVDFLTSGSAMSLEQVPESMLVVGGNAIGLEQGQLFARLGSKVEVVEIAPRIAPFEDPAISAALEQA
    LSAEGIMFHTGANLTNVVPHESGVLATVVAEGRTQQIFAHKILIATGRRPATEGLNLDAVNVSRGDRGEIIVDEHLRTSN
    PRIWAAGDVTGMAQLVYVASAQGTVAASNALGNEPRSLDYTALPRVIFTSPEMAAVGMTPMQAEAAQIAYDVREIPVSFV
    LRAIVSRHDKGIIKMISERETGRILGIHMVGESAGEVIAAATYIISAGLTVDQLAKQWSPYFTMAESLKNVASSAPTLED
    SANG

    >gi|222110447|ref|YP_002552711.1| hypothetical protein Dtpsy_1244 [Acidovorax ebreus TPSY]
    MGSEAFLPDVASHASATPQWWVVCLCAQWCGVCREYRQAFDQTARAWPQMRFEWVDVEDEEEVVGDLDVETFPTVLIADG
    RAARFLGPLLPQATVLGRMLQSLQQASQVATMDSTAQDLFERIRSSRQG

    >gi|222110608|ref|YP_002552872.1| protein of unknown function DUF395 YeeE/YedE [Acidovorax ebreus TPSY]
    MTILWNSFTPWSSLAGGMLIGLAAALLIVLLGRIAGISGIVGALLQRSSWASVANWGWRAAFVIGMVAAPLVWQLIAPLP
    PMEMPSNPLVIVLAGLLVGFGTRLGSG
    CTSGHGVCGLSRLSLRSLAATLTFIGAGAATVFVVRHVLA

    >gi|222110611|ref|YP_002552875.1| Redoxin domain protein [Acidovorax ebreus TPSY]
    MLLVLLGAWQLGTMVHERLAARRGLTGGPHGWRLPLVALIAARLGFVLRYADLYASAPVAVLDIRDGGWSPWAGLGAALL
    YVALLWLRRSPWRQSATAGLATFAGVWLLGWGVLQATAPREQAALPSWQGVALDARTVALPELKGQPVVVNLWASW
    CPPC
    RREMPVILQAREAQSPQSQVRFLWVNQGEPPETVARFAAQQRLPAADVLLDSAGQLGSALGHKALPTTLFYDRQGRLAAV
    RVGELSAATLAQHLALISGHSAP

    >gi|222110698|ref|YP_002552962.1| thioredoxin [Acidovorax ebreus TPSY]
    MASELIKHLSDASFEADVLKAGTPVLVDYWAEWCGPCKMIAPILDEVAGAYQGKLTIAKMNVDENREIPAKFGIRGIPTL
    MLFKNGELAATKVGAMSKAQLTAFIDQQLA

    >gi|222110720|ref|YP_002552984.1| Disulphide bond formation protein DsbB [Acidovorax ebreus TPSY]
    MLLNWIDTAPRRILALISAACVAMLAFGMYLQHVVGLEPCPMCIVQRYALIGVAVFAGLASARGAKGWWMGWTVLALAAA
    GFGGFTAARQSWLQWYPPEIAT
    CGRDFYGMIENYPISRAIPMIFRGSGDCTAVDWTFLGGSIANWSFVWFLVFAVLLLVL
    LVRGGRGAPDTLARA

    >gi|222110721|ref|YP_002552985.1| Glutathione S-transferase domain protein [Acidovorax ebreus TPSY]
    MPATSALPVLYSFRRCPYAIRARMALAVSGQRCELREVVLRDKPAALLAVSPQATVPVLVLPGQVLEHSLDIMRWALAAH
    DPHGWLIPDRGELDAMLELIAQCDGPFKRALDRCKYPNRYPDASPADERAAAHAWLRVLEQRLALEPGGHLFGPRAALAD
    MAIAPFVRQFAGIDDAQWQAAPWPHLRAWLVRWQQSPLFLGVMHKYEAWKPGAPPVVFPPPTA

    >gi|222110790|ref|YP_002553054.1| OsmC family protein [Acidovorax ebreus TPSY]
    MTIQLQRIEGTPMAQRLTIRSHEWVVDGTAAEGGDDTGPNPHDLYDAALGGCKALTLLWYARRKGWDVQDVRTVVERDAS
    QERSGTYRLATRLQVQGDLSDAQIAELQAAIGKCPVHKLMTQVTTEITTVVERA

    >gi|222110824|ref|YP_002553088.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Acidovorax ebreus TPSY]
    MSQPLDVIILGAGSAGLAALREVRKRTDQWRIVNDGPWGTTCARVGCMPSKMLIEAANAYHARRALHTFGIEGADALRVD
    LPAVLRRVRALRDDFVAGTLAATDAGERAISGHARLLDAQRVEVNGQVHTARRIIIATGSRPIVPEDWLAFGDRILTTDT
    LFEQPTLGPRVAVIGLGPLGVEIAQALARLGVEVMAFATGKSVAGLSDPAINDALLARLKDEFIVNVGDKAELREVAGGI
    QVTNGSATVVVDQVVAAMGRRPNLEHLGLDTLGVALDDKGRPPIDPCTLQVGDLPVFIAGDADGDRPLLHEAADEGHIAG
    LNALAPTPRGFARRTPLAITFSQPHAAVVGQRHADLPQGQWVVGTVDFARQGRARVAQCNHGRLNVYAEHGSGRLLGAEL
    CTPAGEHMAHLLALAVEQRLTVHDLLRMPFYHPVLEEGLRTALRDAASRLPKASDSDLAACEAYGASALD

    >gi|222110834|ref|YP_002553098.1| iron-sulfur cluster assembly protein IscA [Acidovorax ebreus TPSY]
    MAITLTEAAARHVTRYLARRGKGVGVRLGVKTTGCSGLAYKLEYVDEQAPEDVVFENHGVKVLIDPKSLAYIDGTELDFV
    REGLNEGFRFNNPNERDRCGCGESFRV

    >gi|222110846|ref|YP_002553110.1| glutaredoxin [Acidovorax ebreus TPSY]
    MSIIRNAAVLATTCATAALLSTAALAQQVYRIVGPDGKVTFSDRAPAANAEGTAVGAGPRSGGGGAEALPYALRQVATRF
    PVTLYTSSD
    CVPCNSARNLLINRGIPFTERTVSTNEDIDALKRMSGESSLPFGTIGAQQLRGFSDTEWTQYLDAAGYPKQ
    SQLPPNYRRPAAAPLVAVPAQPAAPAADKASAAPARRPSAPPAAPTGPSPSNPAGIIF

    >gi|222110853|ref|YP_002553117.1| dihydrolipoamide dehydrogenase [Acidovorax ebreus TPSY]
    MAIIDIKVPDIGDFAEVGVIEVLVQPGDTIRAEQSLVTVESDKASMEIPSSHAGVVKELKVKLGDKVAEGSVLLTLEVAQ
    GAAAPAAAPAAASTPSAPPSESKPAPAPAVQAPAAPKTEAASFGGSADVECDVLVLGGGPGGYSAAFRAADLGLNVVLVE
    RYATLGGV
    CLNVGCIPSKALLHVAAVMDEVSHLKSAGIDFGAPQVHIDTLRGHKEKVIGKLTGGLAQMAKMRKVTVLRGY
    GHFVGANHLEVEETTGTSQDKTGAKKVVAFKRAIIAAGSQAVRLPFMPDDPRVVDSTGALALQGVPKRMLILGGGIIGLE
    MGTVYSTLGARLDVVEMMDGLMQGADRDLVKVWQKMNQHRFDNVMLNTKTVAAEATPEGIKVSFAPAKDGVTVPEPQVYD
    LVLQAVGRTPNGKKIAAEKAGVAVTDRGFINVDIQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGELQGNKEL
    ASAAFNARVIPSVAYTDPEVAWVGLTEDQAKAQGIKVKKGLFPWAASGRAIANGRDEGFTKLLFDDSPEAHGHGRILGGG
    IVGTHAGDMIGEIALAIEMGADAVDIGKTIHPHPTLGESIGMAAEIAHGSCTDVPPQRR

    >gi|222110950|ref|YP_002553214.1| uncharacterized peroxidase-related enzyme [Acidovorax ebreus TPSY]
    MAERYPFPDLNTLPEDIRARILEVQEKAGFIPNVFLAFARRPAEWRAFFAYHDALMLKEEGSLTKGEREMIVTTTSAANQ
    CLY
    CVVAHGAILRIYEKKPLVADQVAVNHRKADIPPRQKAMLDFAMKVCQRAHEIEDADFEALYPHGFDDEDIWDIAAIT
    AFFGLSNRMASFAGMQPNPEFYLMGRLPREKKA

    >gi|222111021|ref|YP_002553285.1| methylated-DNA/protein-cysteine methyltransferase [Acidovorax ebreus TPSY]
    MQYPRDTVQSRIATALGDVRLAASAKGLVGLWFDGQRHQPAQLDAAPVWPTDDAHPVLRAAAQQLQQFLRGERTRFDLPL
    DLSGGTPFQQAVWQALLAVPHGATTSYGALARQIGRPTAVRAVGAAVGRNPLSVVVP
    CHRAVGSAGALTGYAGGLPRKKA
    LLALESGPQARAVPFTPLLNFA

    >gi|222111029|ref|YP_002553293.1| Rhodanese domain protein [Acidovorax ebreus TPSY]
    MIDHVRPAQLADWLTANAGSRPLVLDVREPWELQTASVTPQGFELVAIPMGELAARLDELDPARPVACLCHHGMRSLRVA
    GFLAHQGFDQVANITGGIEAWSHERDPAVPRY

    >gi|222111032|ref|YP_002553296.1| peptide methionine sulfoxide reductase [Acidovorax ebreus TPSY]
    MSDLQSITLGGGCFWCTEAVFDRVRGVTDVQSGYANGDVAEPTYEQVCSGTTGHAEVVRVTFDPAQIGVREILEIFFATH
    DPTTLNRQGNDVGTQYRSAIYFADPAHQDVAEELLRQMGQDKLFGAPVVTEVAPLVNYWPAEDYHQDYYRNHPNQGYCAF
    VVGPKVEKFRKTFARHLKPGA

    >gi|222111097|ref|YP_002553361.1| dihydrolipoamide dehydrogenase [Acidovorax ebreus TPSY]
    MSKQFDVIVIGAGPGGYIAAIRAAQLGMNVACIDEWKNAAGGAAPGGTCTNVGCIPSKALLQSSEHFEHANLHFADHGIT
    ATGVKMDVAKMIARKDNVVKQNNDGILYLFKKNKVTFFHGRGSFVKAVDGGYEIKVTGKAEETLTAKQVIVATGSNARAL
    PGAAFDEEQILSNDGALAIGSVPKKLGVIGSGVIGLEMGSVWRRLGADVTILEGLPTFLGAVDEQIAKEAKKAFDKQGLK
    IELGVKIGEVKAGKKGVSIAYTNAKGEAQALEVDKLIVSIGRVPNTTGLNAEGVGLKLDERGAVVVDGDCKTNLPGVWAV
    GDVVRGPMLAHKAEEEGVAVAERMAGQHGHVNFNTIPWVIYTSPEIAWVGRTEQQLKADGVKYKAGTFPFLANGRARALG
    DTTGMVKFLADAATDEILGVHIVGPMASELIAEAVVAMEFKASSEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|222111164|ref|YP_002553428.1| Thioredoxin domain protein [Acidovorax ebreus TPSY]
    MPFAATHLAQPPSRETVDQWLGPTVLEFGTPWCGHCQRAQPLIEQALEDRDDVRHVKVEDGPGQRLGRSFGVKLWPTLVF
    LRDGRETARLVRPQTAQSIHEAVQGITATTG

    >gi|222111220|ref|YP_002553484.1| methionine-R-sulfoxide reductase [Acidovorax ebreus TPSY]
    MTYPIQKTEDEWQALLQAKGAEPAAYQVTRHAATERPFSGKYEGHWADGSYHCVCCGAKLFDSDTKFDAGCGWPSFSLAV
    PGAIREIEDRSHGMVRTETVCAQCGAHLGHVFPDGPAPSGLRY
    CMNSASLDFEPPAP

    >gi|222111246|ref|YP_002553510.1| Rhodanese domain protein [Acidovorax ebreus TPSY]
    MKKLLALAVFATAAHVAPAAWAAQPLLTPAELKAQTTQATPPRVIDIRDPASYGAQHIPGAVNAPYGKWRGPASNPGELP
    DLPRLTALVQSLGLTPTTHAVVVSTGADPTDFGAAARVYWTLKLLGLKELSILNGGMKAWGQAQLPLTAEVPQVAASQYT
    PTLDTRLLATREDVGQHIRLSNAALVDSRPDAFYQGKVRAPAAKVSGTLPGAQQLDFNQWFVPGTSTFVDAATARQIAAK
    VKREQGQDMVAF
    CNTGHWAATDWFGLSEVAGLPGVKLYAGSMVDWTQSQDPPLMANQPTRAEALAYDAKQWWERKLK

    >gi|222111247|ref|YP_002553511.1| protein of unknown function DUF395 YeeE/YedE [Acidovorax ebreus TPSY]
    MKRLPLATLLAIFLGWLLWAVSVRQAVLFAVGLGLGAVLAGQRFGFTTGWRMLIEDKDASGVMGQLLLLALAAAMAMPLL
    GHFPELTAALGPPSVSLLVGAFVFGLCMQIADG
    CGSGTLYKAGLGIPMNAAILPLFALGSFLGSMHLGFWLDLGRAQPVG
    LVNRFGWQQALLITLAVLAVVAVGVRWYARRAQRPQGTQPQPLLVRRWIVGAVLLALLATLNLVIAGQPWGVVYGFGLWA
    AKLAQASGAADLAGNWFWSQPGNAARLQETVLLDVTSITNIGILGGALWVSAGKPVTAKALTGTQWAVALVAGLLLGYSS
    RLAFG
    CNVGAMLSGISTGSIHGWIWVPLAFAGTIFGLRIRRHFGF

    >gi|222111319|ref|YP_002553583.1| Mercuric transport protein MerT [Acidovorax ebreus TPSY]
    MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTVLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGE
    VCAIPQVRATYKLIFWIVAVLVLVALGFPYVVPFFY

    >gi|222111320|ref|YP_002553584.1| mercuric transport protein periplasmic component [Acidovorax ebreus TPSY]
    MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
    ADAGYPSSVKQ

    >gi|222111322|ref|YP_002553586.1| mercuric reductase [Acidovorax ebreus TPSY]
    MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAIEVGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLD
    KMRDLLGRNDKTGSSGALHIAVIGSGGAAMAAALKAVEQGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNLIVQLNDGGERVVAFDRCLIATG
    ASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFR
    MEGIEVREHTQASQVAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDPGMRTSVEH
    IYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPTVVFTDPQVATVGYSEAEAHHDGIKTDSRTLTLDNVPRA
    LANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLS
    C
    CAG

    >gi|222111334|ref|YP_002553598.1| heavy metal translocating P-type ATPase [Acidovorax ebreus TPSY]
    MNKEPSNACGCSGGNGQKTGCATEQANTETTVFHVSNMDCRNEEALVRRTLEGTPGIERLQFDLPKRLLTVSHREVSADA
    LEQALNSVGMKAQALRDAAVLTTYRIENMDCPSEEKLIRSHLGTVEGIQDLDFDLAERTLSVKHLAQAREQMEQVLASIG
    MRAKEQTASQTGPATAAPAAAVEPAVLQDQPAPPVSTPPAGERVTYRIENMD
    CPTEEALIRNRLGKEPGVTALDFNLMQR
    VLGVQHTLASTAPIEKALASIGMRASRQDLQAVTTVLHIAKMD
    CPTEEGLIRGKLQSMPGVQGMDFNLMQRTLTVRHTPD
    AIKPAVEAIESLGMETKVQTTDEPHDPQAPAQKTNWWPMAVSGVAAVAAEGVYWVNDGNHWAVIALALVSIFTGGLSTYK
    KGWIALKNRNLNMNALMSIAVTGGMAIGHWPEAAMVMFLFALAEVIEAKSLDRARNAIRGLMDLAPETATVRQADGSWIE
    TPAKEVMQGAVVRVRPGERIALDGQITAGRSAINQAPITGESLPVEKTEGDQVFAGTINETGSFEYKVTAGAGDSTLARI
    IHAVESAQGSRAPTQRFVDQFARVYTPAVFAVAVLVAVVPPLAFGGAWFDWVYKALVLLVIACPCALVISTPVTIVSGLA
    AAARRGILIKGGVYLEGGRKLKALALDKTGTLTHGKPEQTDFVPLIGEAQEVAAWAASLAARSDHPVSKAIARKASRDGI
    ALHEVGDFAAVPGRGVRGRIAGRMLHMGNHRLAQELGLSEAALQARLETLERQGKTAILLMDDATVLGIFAVADTVKESS
    RAAVADLQALGVRTLMLTGDNQHTAAAIAAQIGISEARGDQLPEDKLKTIEGLVGGEGQVGMVGDGINDSPALARADIGF
    AMGAAGTDTAIETADVALMDDDLRKIPTFIRLSRSTAAILTQNIVLALGIKAVFLALTFTGHATMWMAVFADMGASLLVV
    FNGLRLLKTQKA

    >gi|222111380|ref|YP_002553644.1| transcriptional regulator, ArsR family [Acidovorax ebreus TPSY]
    MKSRLLKDMLYEQVARIGKSLASPKRLELVELLAQGEKSVETLAAQADLDMRLASAHLKALREARLVVTRREGKYIYYRL
    SGPDVSQLWVAMRETAEEHLLELRLALEQMTSQPDTLVSESRESLLEKARQGEIVVIDVRPVSEFNAGHLPHARSLPLDE
    LERRLAELPMDRAIVAY
    CRGPFCLMSDEAVVLLAAKGYRIRKIRDGVSEWQAAGFPVEQGA

    >gi|222111382|ref|YP_002553646.1| DsrE family protein [Acidovorax ebreus TPSY]
    MKTLIIFNREPYDNTDVTWNGLRLADKLLEAGSEVRLFLMNDAVDMARDVCRPPEGYDQDLSKMLKDLIAKGVPVKVCGT
    CMSRCGIYKNHPYFDGAEQSTMSALAQWVIECDKVITF

    >gi|222111404|ref|YP_002553668.1| arsenate reductase and related [Acidovorax ebreus TPSY]
    MSTPTIIVYGIPNCDTVKKARAWLQEQGLAYQFHDFKKQGVPAERLPAWMAAVGWEKLLNRQGTTWRKLDATVQAGVTDA
    PSAATLMCEQPSVIKRPVVEWQGSPAGDVTVGFSPEAWNARAASHSKA

    >gi|222111411|ref|YP_002553675.1| alkylhydroperoxidase like protein, AhpD family [Acidovorax ebreus TPSY]
    MSSAPRINLPRHAASYAAMYGLQKHVDAGQLPVQLHELVKMRASQINGCAFCIDMHAREAREHGESDRRLHLLSAWRESG
    VFDARECAALAWTEALTRLEQSQASDAVYDEVRAQFSEAEIVELSMAIVTINGWNRLNVAFRTPPGRYTPA

    >gi|222111541|ref|YP_002553805.1| alkyl hydroperoxide reductase, F subunit [Acidovorax ebreus TPSY]
    MLDANLQAQLKAYLERLQRPVELVATLDDGATSQELRELLQEIRSLSDKITVVEKNDAPVRKPSFLITNPGVDTGVRFAG
    VPLGHEFTSLVLALLQVGGHPSKESADLLEQVKGLDGDFHFETYYSLS
    CHNCPDVVQALNLMSVLNPRITHTAIDGAVFQ
    DEIKERQIMGVPTVFLNGKNFGQGRMELAEIVAKIDSGAHARVAAKLNAMEPFDVLVVGGGPAGAAAAVYAARKGIRTGV
    AAERFGGQVLDTVDIENYISVSKTEGPKFAIALEQHVNDYDVEVMNLQRAKALKPAATEGGLVEIELDNGATLKSKTVIL
    STGARWRNMNVPGEEQYRTKGVTY
    CPHCDGPLFKGKDVAVIGGGNSGVEAAIDLAGIVKSVTVLEFASELKADGVLQKKL
    RSLPNVTVILNAQTTEVNGDGSKVTGLTYKDRTTDEAKTVAVEGIFVQIGLLPNTDWLKGTVDLTRFGEIIIDARGHTNV
    PGVFAAGDCTNVPYKQIIIAAGAGATAALSAFDHLIRH

    >gi|222111542|ref|YP_002553806.1| peroxiredoxin [Acidovorax ebreus TPSY]
    MSVLNTTIKPFKTQAFKNGKFVEVTEKDVLGKWAVFFFYPADFTFVCPTELGDVADHYDELQKLGVEVYSVSTDTHFVHK
    AWHDASDTIRKIKYTMLGDPTWQISQNFDCLREGQGLADRATFIVDPQGVIQAMEITAEGIGRNAADLLRKVKAAQYVAS
    HPGEVCPAKWEEGAKTLAPSLDLVGKI

    >gi|222111733|ref|YP_002553997.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidovorax ebreus TPSY]
    MAIVVNKPLPEFEANATGGIKVSNVSHQGQILILYFYPKDNTPGCTTEAMQFRDKFKDFEKAGAVVFGVSRDNMKSHDDF
    KEKLELPFELIADTEEKMCHMFGVVKNKIMYGKKVKGIERSTFLVNPEGILVQEWRGLKVPGHVDEVLKAVKAIKAPVKK
    AA

    >gi|222111891|ref|YP_002554155.1| thioredoxin reductase [Acidovorax ebreus TPSY]
    MSTTQHAKVMILGSGPAGYTAAVYAARANLNPVLITGLAQGGQLMTTTEVDNWPADVNGVQGPELMQRFQEHAERFKTQI
    VFDHISQVDLSKRPFTLTGDSGTYTCDSLIIATGASAKYLGLPSEEAFMGKGVSA
    CATCDGFFYREQDVCVVGGGNTAVE
    EALYLSNIARKVTLVHRRDKFRAEPILIDKLMEKVAAGKIELKTFFTLDEVLGDATGVTGIRLKHTEDGHTEDIALQGCF
    IAIGHAPNTDIFQGQLAMENGYIVTQGGLKGFATQTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQQE

    >gi|222111923|ref|YP_002554187.1| alkylhydroperoxidase like protein, AhpD family [Acidovorax ebreus TPSY]
    MTSSTDYKALTREISSNVSELRNSVPQVMQGFNALGKAALAGGAIDAKTKELIALGIGVAARCDGCIGFHTQALARLGAT
    RAEVHEVLGIAVYMGGGPALMYAANAVAAFDECAPAQAPAATA

    >gi|222111972|ref|YP_002554236.1| selenide, water dikinase [Acidovorax ebreus TPSY]
    MNASAPTAAPSHPRLTSLSHGGGCGCKIAPGVLSQILQQSGAGAVMPPELMVGIETSDDAAVYRLNESQALVATTDFFMP
    IVDDPYEFGRIAATNALSDVYAMGGKPIVALALVAMPVNTLPLDVIGAIVRGGQDVCRAAGIPIAGGHTIDSVEPIYGLV
    AMGLVHPDRVRRNAGAQPGDVLVLGKPLGVGVYSAALKKEQLADAHYREMIAATTRLNTPGPLLAELPGVHAITDVTGFG
    LAGHALEVARGAGVTVQIDWSRVPLLPGVADLAAAGFVTGASGRNWAGYGEGVALAAGLPATAQALVTDPQTSGGLLVAC
    APDSVQDVLGVFAREGFAQAAVIGSVQAGPARLELR

    >gi|222111996|ref|YP_002554260.1| glutaredoxin 3 [Acidovorax ebreus TPSY]
    MQAVKMYTTAVCPYCIRAKQLLKLKGVEQIEEIRVDTDPAARQHMMEITGRRTVPQIFIGDTHVGGHDDLVALDSRGGLV
    PLLGA

    >gi|222111997|ref|YP_002554261.1| Rhodanese domain protein [Acidovorax ebreus TPSY]
    MNFVLDNWYLIFLALASGVMLLLPALKGAGAGTLGTAQAVQLINREKAVVIDVCEPEEFAAGHVGGAKNIPLGQLQERLP
    QVAKNKAVPIILV
    CAKGARASRAAGIAKGLGYEKAQALAGGLTAWREANLPVEKA

    >gi|222112000|ref|YP_002554264.1| UBA/THIF-type NAD/FAD binding protein [Acidovorax ebreus TPSY]
    MNDDQLLRYSRHILLDEIGIEGQERILAAHVLVIGAGGLGSPAALFLGSAGVGTLTLVDDDVVDLTNLQRQIAHTTARVG
    TPKVDSAAQAVQAINPLVSVRTVRQRVDAAALDGLVNAADVVLDCTDNYQTRQAINAACVRQRKPLVAGAAIRFDGQISV
    YDPRRDDTPCYACLFSPTARFEEVQ
    CATMGVFAPMVGIIGTMQAAEALKLLVGVGSSLAGRLLMLDGRDMQWTEVRTERD
    PACPVCGSLHSPAR

    >gi|222112019|ref|YP_002554283.1| electron transport protein SCO1/SenC [Acidovorax ebreus TPSY]
    MGVAGTFAACSPKAPKFQGVDLTGAEYARDLQLTDHNGQPRSLKDFAGKVVVVFFGYTQCPDVCPTSMSELADVKRALGA
    DGDKLQGIFVSVDPERDTPEVLKAYMANFDPSFLALRGTPEQLAAVAKDFKIYYKRVEGQTPTSYTMDHSAGSYVYDPAG
    RLRVYHRYGSGAQSLAADVRALLDETR

    >gi|222112057|ref|YP_002554321.1| arsenate reductase [Acidovorax ebreus TPSY]
    MTSAAITIYHNARCSNSRGALALLRERGIEPTVVDYLAQPLDAVQLTALVARLGVPVREVMRTKEAAYTALDLADPGRTD
    AELIAAIAAHPVLLNRPIVVTPRGALLCRPPERVLELL

    >gi|222112101|ref|YP_002554365.1| Thioredoxin, conserved site [Acidovorax ebreus TPSY]
    MKLLPTLLAATALFLGLNASAQDAAIRKALAERIPQLQQIDEVRSTPMKGLYEVRIGTDLFYTDAQGNYLIQGELIDTKA
    RRNLTEDRINKLTAVDFKALPLQDAFTLVRGNGERKLAVFEDPN
    CGYCKRFEKDMQNVDNVTVYLFLYPILSPDSAEKSR
    NIWCAKDRAAAWDDHMLRDKTPAAASCDTAALQRNLAFGRKHKITGTPTLIFADGSRVPGAIGAQDVEKRLAAAGK

    >gi|222112120|ref|YP_002554384.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidovorax ebreus TPSY]
    MNEPTLSSSASADSAKAPSAHPLRRRRWLLVGAGALAALGGAGLATWRLRPGPVQEGVSDAVWGAQFEGPAGEVLSLAAL
    RGRPLLLNFWATW
    CPPCVEELPLLNAFYGEHRAKGWQVVGLAIDQPSNVRKFLERMPLDFPIALGGLGGTDLARGLGNEK
    GGLPFTVLFGANGSILKRKMGQLTAQDLQGWSTTL

    >gi|222112296|ref|YP_002554560.1| cytochrome c biogenesis protein transmembrane region [Acidovorax ebreus TPSY]
    MSCLRPLQRSLHTLFFIAACAVSTGAIGQIQLKTTAAAGSSSVVTPHVRAELVAQAPDGVGPGKPLWLGLSITHQPEWHT
    YWKNPGDSGLPTQLEWQLPAGIDAGEVAWPVPKKIPLGNLANYGYEGTVLLPVPMTVSPAFNPGPLAKEATFQLKASWLV
    CRQECIPEEGSFTLQLPLQGTTALHAAAFDAAAAAHPRDLPALGGSSAQVEGDAVLLRVAGLPPALQGQTLEVFPETTGV
    VETAATPAQQWDGAVWTARLPLSPQRSDGPVPMPVVLAHGGQGWRAELPVPGGWPAVAALKGMSPALEAALKANAANAAA
    PAAPAAATPAPLGTWLAALAGALLGGLILNLMPCVFPVLAIKVVGFARHAQNQRAHRIGGLAYTAGVVLSFLLLGALMLG
    LRTAGEAVGWGFQLQSPAVVASLAALFTLIGLNLAGVFEFGRMLPSSLAGLQARHPVLDAFLTGVLAVAVASPCTAPFMG
    ASLGLTATLPAGQALSIFAALGLGLALPYLLASWLPAFARALPRPGAWMDTLRRLLAFPMFATVVWLVWVLGQQSGINGA
    AALLALLVALSMAVWALTLRGATRAVLAPLSIAACAWLVWLWGPKIIELESTPMAAASAPSGVAGVTSWQPWRPGLADEL
    VAQGRPVFVDYTAAW
    CVTCQYNKNTTLASAAVLQDFATKNVALLRADWTRRDPAITAALAQLGRSGVPVYVLHAPGKAPV
    VFSEILGESELRAAMSAL

    >gi|222112327|ref|YP_002554591.1| uncharacterized peroxidase-related enzyme [Acidovorax ebreus TPSY]
    MTDTIDQLARLGHAPHAQAARQQRAKAITATQACEDLLLAPQLPGGLALAERLSVAQAVAAASGVATLADHYGARLAGLP
    APAADARWQAITHFTQLLTTQPAAADRAALLALPQAGLATPDVVLLAQLIGFVAYQARLVAGVAALAALGPAGTAATAVA
    PTTPDAPFVHPANLPPPGEPLRLAGYTSETLDWKAWLPVVDPATASAEQNAVLDASHPKARTSDFYLVLAHQPRVLAERS
    EAFNAIMYAPGGLPRAEREVATTVVSRINGCVY
    CAAVHAQRFEQLAKRNDVIAQIFADPDSAGTNARERALAQASAALTR
    APGAFGPQHLAPLRAAGLSDLEILDTVHAAALFAWANRLMLNLGEAVYP

    >gi|222112444|ref|YP_002554708.1| thioredoxin [Acidovorax ebreus TPSY]
    MIDVTLENFETEVVAASMQVPVLVDFWAPWCGPCKTLGPVLEKLEVEYAGRFTLAKIDSDQEQQLAAMFGIRSIPTCVLM
    MNGQPVDGFMGAQPESQLRAFLDKHVPSAEELQAEEQEEEALDALAEGDTEGALEKLQHAVATDPANDDARFDYVKLLLQ
    LGREDDAKVAFAPVIAKAEVSRRLGALKAWMDALDFIASSAYGAGAGAEFDAKIAANKRDFETRFARARWLMAQQRWQEA
    MDELLEILMRDKAWNDDAARKAYVAVLEIIEPPKVKVADGQIPPEDPVVASYRRRLSSVVLS

    >gi|222112537|ref|YP_002554801.1| glutathione peroxidase [Acidovorax ebreus TPSY]
    MPRLTLPLLLCATLLGPAAQAADVAAPPAADARACPALLQHTVPRLQDEAPQALCQYAGKVLLVVNTASYCGFTGQYQGL
    EELYARYRDQGLVVLGFPSNDFAQETGSNTEIAQFCENTFGVRFPMFAKSHVKGGEALPLYRQLAAASAGQTPRWNFHKY
    LVSRSGKVVGSYGSSVEPHSKALIQAIEQQLAAPR

    >gi|222109875|ref|YP_002552139.1| OsmC family protein [Acidovorax ebreus TPSY]
    MECTVSWTGNAGTRSGMGFVAETGSGHVLAMDGAPDADRPENGGQNLAPRPMETVLAGTGGCTAYDVVLILKRGRHDVRG
    CSVKLTSERAQVDPKVFTKIHMQFTVTGRGIPPAAVERAIAMSHEKYCSASIMLGKTAQITTGFEIVEA