Burkholderia mallei NCTC 10247 uid58385

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126446373|ref|YP_001077481.1| hypothetical protein BMA10247_A0276 [Burkholderia mallei NCTC 10247]
    MPLIHATAEMAPDAPNYVVELEAGKHRLQGDENEHEGGGNVGPAPYELVLSGLAACTVATLRMYMQRKAWPAARLLARAE
    LHVDREGAQYVRRTIVVDGAQRTRLAEIAEKTPVTLFVKRGTRIETTLK

    >gi|126446026|ref|YP_001077539.1| organic hydroperoxide resistance protein [Burkholderia mallei NCTC 10247]
    MNILYKTAATSTGGRDGRATSHDQKLDMKLSAPRELGGAGAEGTNPEQLFAAGYSACFLSAMKFAAGQNKQTLPADTTVT
    AEVGIGPNEEGGFALDVELRVALPGLDAAAAKTLVDRAHHV
    CPYSNATRNNVAVRLVVA

    >gi|126446597|ref|YP_001077563.1| rhodanese domain-containing protein [Burkholderia mallei NCTC 10247]
    MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTDLGEQAYAAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDA
    LVDTLKAHGLRQNQQIVAYDAQGGMYAARLWWLLRWLGHDSVAVLDGGLQAWQSEGHAVSQDTPPKSMGDFRAGAPLATV
    VDAQTVLANLATKDRLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTADGRFKSGHELREAFSPLLGATEPKKV
    ILQ
    CGSGVTACHNALAMEIAGLHDPALYAGSWSEWSADPSRPVATGANP

    >gi|126447475|ref|YP_001077595.1| dedA family protein [Burkholderia mallei NCTC 10247]
    MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPDALGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRA
    LKTLCKLSLSRDSCVKKTERFFGRWGVRVLAVARFIPGLSLISVPMAGALGTRYRVFVGYDGLGALLWAGCGVAIGFAFA
    KQIDWLFAGANQLGRAVLVVIVALLAVYTAVRWMRRRALIRQLANARIDVDELERLLRAEPAPVVFDARSPEHRKLDPYA
    IPGAQFADERDLRDIVAHYPATQKFVIYCS
    CPNEVSAALMAQRLKQAGFADALALRGGLDAWRDTGRQLIELAPQPPSEA
    PVLAAAPKTA

    >gi|262192887|ref|YP_001077628.2| ArsR family transcriptional regulator [Burkholderia mallei NCTC 10247]
    MTREAQVSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERSVEDLTALSGMSFANTSRHLQILRRARLVDTERRGK
    NVVYRLAGDSEVVGLMKALGRLGERNVAEVNRVLGDYFHARDSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGA
    LNIPLAALEARLSELPADTEIVAY
    CRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGFVVETEPAN

    >gi|126446624|ref|YP_001078018.1| selenophosphate synthetase [Burkholderia mallei NCTC 10247]
    MTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAAL
    GVVHPARVKRNAAARAGDVLVLGKPLGVGVLSTALKKDRLDAQGYAQMIATTTKLNRPGTALAALPGVHALTDVTGFGLL
    GHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASGRNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAP
    EAVDDVLACFRDDGFERAAAIGEMVDGAARVDVS

    >gi|126446291|ref|YP_001078588.1| YeeE/YedE family protein [Burkholderia mallei NCTC 10247]
    MAVDFVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLLAGGRSDAGWRAAFLVGLIAAAVAANALDWFSMPAV
    DAGWARVIAGGVLVGIGTRYAGG
    CTSGHGVCGISRGAPRSIVATAVFMAAGIATVFVLRHVVGG

    >gi|126447133|ref|YP_001078597.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10247]
    MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVATGHARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRN
    PRFVRELEAKTGKDAVVLLL
    CRSGNRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS

    >gi|126447211|ref|YP_001078749.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10247]
    MSHVTEIPAADSAAAVAHFAASLAFETDCRDVHDALACGAPDFVLLDVRGPEQYAAAHVPGALNLPHRKIIESKLSEFAR
    DTCFVVY
    CAGPHCNGAARAALRLARLGRPVKLMLGGVTGWLDEGFALARGNGASRRQGGLRQRTAGNDPLRNRNN

    >gi|126445919|ref|YP_001078899.1| dedA family protein [Burkholderia mallei NCTC 10247]
    MPIHAAHAPRRASRLSAAPMPPGSAFVAFEVRFVWHFPQAVPASLGPWAVFASVLVTQLGMPVPAVPMLIVGGTMAAMGQ
    ASYASMLVAAVAATVLADSMWFFAGRARGRRLLNALVRFSLSLDTTLRIARKVFEKHGAPLLVLAKFLPGLGLVSAPLLG
    TTAVAVWVFLFWDVAGASLWASVWLFGGAALHDEIVRLMQWVSASGGTLFDAFAAIFVTFLLYRWAMRMRFRRWLAKIRI
    SPQQLDAMLKSAAPPIVFDARPRAVREKEAYRIAGAYPLDLDSPDPLHPDLMTRPIVVYCV
    CPNEATAKRIVSQLQRKRI
    RHALALKGGLDAWEKHGYPVEPLPADFDAARYAAPPPVERIAPLEPGGRDGGYPMRAGLTD

    >gi|126446081|ref|YP_001079095.1| putative thiol:disulfide interchange protein DsbC [Burkholderia mallei NCTC 10247]
    MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEVNLGSQIVYSDASGDYVLLGE
    LVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STVKSKSIWCASDRVKSWQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
    VK

    >gi|126446158|ref|YP_001079122.1| glutaredoxin-related protein [Burkholderia mallei NCTC 10247]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFTA

    >gi|126445589|ref|YP_001079221.1| alkyl hydroperoxide reductase, subunit C [Burkholderia mallei NCTC 10247]
    MPIINSPIKPFKATAYHNGDFVQVSDETLKGKWSVVVFYPADFTFVCPTELGDLAERYAEFQKLGVEIYAVSTDTHFTHK
    AWHDTSDTIAKIKYPMIGDPTLAISRNFDVLIEEEGLALRGTFVINPQGEIKLCEIHDNGIGRDAGELLRKVQAAQYAAA
    HPGEVCPAKWTPGADTLTPSLDLIGKI

    >gi|126447169|ref|YP_001079470.1| dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10247]
    MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAGEFDKVRGFAGDSPLGIRTQA
    PAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDARVVDGKTVDVDTGGGARVRIQ
    CEHLLLAAGSEPVELPAMPF
    GGNVISSTGALSPGRLPKRLVVVGAGYIGLELGIAYRKLGVEVSVVEARERILPIYDAELTKPVAASLKRLGVRVLLGHK
    VLGLNARGDAVCVQDDAHAQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKVDDMCRTSMRNVWAIGDLTGEPML
    AHRAMAQGEMVAEIVAGKKRHFMPAAIAAICFTDPEVVSAGLAPDEAERTFGACVSASFPFAANGRALTLESADGFVRVV
    ARRDDHLIVGWQAVGAGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI

    >gi|126447456|ref|YP_001079484.1| pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia mallei NCTC 10247]
    MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGV
    RAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEI
    AATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
    VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVS
    IFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDP
    NYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
    YESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETG
    EPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVE
    VMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
    YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA

    >gi|126446583|ref|YP_001079518.1| putative lipoprotein [Burkholderia mallei NCTC 10247]
    MKTAIRKLTASLLVAAAAACFAADAPHAPEHLPPGIAWRQGDVDAAFAEAKRTNKPLFLYWGAVWCPSCNQVKSTIFSQQ
    AFKSRSSFFVPVYLDGDTENAQKIGDRFKVRGYPTMILFRPDGTELTRLPGEVDLDRYMQALSIGLNASHPFKRTLAAAL
    KDGARVTPDEWRVLADYSWDTDGDLPVPGERVAATLQALARHARADHANAQALRLDLKAAVSAAAGDPPQQGDVDKAAAA
    AAVRDALRDPKRARADYDVLVAAPAEVVAYLAGGDAAARALLAKQYDAALARLSTDASLAAIDRTMALHGRVRVARLDAR
    PGAPLPPALADAVRRQTASAVTESTNVYGRQAVVSEAADTLTDAGQFDAADALLKAELVRSPTPYYFMSGLAANAKARGD
    RAAALDWYRKAYEAASGSATRLRWGAAYFANAVDLAPDDAAQIRRIANDVLTQASQTRNAFYGANRRALTRVVTQLARWR
    QRGAHDAAAQAVVKQFEGVCGKLPVGDPQVGTCEGLLKTAKA

    >gi|126446335|ref|YP_001079579.1| arsenate reductase [Burkholderia mallei NCTC 10247]
    MITIYHNPRCSKSRETLALVETLNPTGEAINVVEYLKQPLTAAQLKVLHRQLGRPVRDMIRDNEAPYKDLNLADAALSDT
    QLYDAIAEHPILLQRPIVVHGDKAAIGRPPEAVRSLFE

    >gi|262193285|ref|YP_001079682.2| peptide methionine sulfoxide reductase [Burkholderia mallei NCTC 10247]
    MSEATSEVATLGGGCFWCQEAVFLDVDGVTAVESGYAGGHTRNPGYRDVCDGDTGHAEVVSVSFDPARIGYREILEIFFA
    THDPTQLNRQGNDVGTQYRSVIFTHSDAQRDAALELIRTLERDKLYDDPIVTQVEPLNGNYWPAEAYHQNYYARNPGQGY
    CAVVIGPKLAKFRQKFAHRLKSRGA

    >gi|126450548|ref|YP_001079696.1| methylated-DNA-protein-cysteine S-methyltransferase [Burkholderia mallei NCTC 10247]
    MFNAVIDAPFGKVGIRTDASVVREIVYLPESIKRVAPGTPLAKQAARQIELYFERASARFDLPLAEVGTPFQHRVWHAIC
    AIPPGVVLTYGQIAKQIGSAPRAVGQACGANYFPLVIP
    CHRVVASGGLGGFANHDDEGYFLKVKRWLLAHEGVRY

    >gi|126448888|ref|YP_001079747.1| disulfide bond formation protein B [Burkholderia mallei NCTC 10247]
    MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFIGAGMASGAGVAVTEALIVLS
    AAAGVGTAARHLYVQLNPGFS
    CGFDALQPVVDSLPPARWLPGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVS
    LLRHRGRLR

    >gi|126449088|ref|YP_001080561.1| dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10247]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENAQHHLADHGIS
    VDGVKMDVAKMLARKDGIVEKMTGGIEFLFKKNKITWLKGHGKFTGKSDAGVQIEVSGEGETQVVTAKNVIIATGSKARH
    LSNVPVDNKIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIDGVKTGANGVSIAYTDKDGNAKTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|126449535|ref|YP_001080679.1| thioredoxin [Burkholderia mallei NCTC 10247]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|126450702|ref|YP_001080711.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10247]
    MSVEVDRQVPDFTAPATGGEFSLSGIKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHENFK
    AKLELPFLLISDPDETLCALFGVMKLKKMYGKEVRGIERSTFLIDGAGMLRHAWRGVKVPGHVDDVLSAVQAL

    >gi|126450377|ref|YP_001080758.1| hypothetical protein BMA10247_1204 [Burkholderia mallei NCTC 10247]
    MGSNMSFSRSEAAPAAPLPDLAATLAAPRDDAFQQLGAAFVTRLPAAPLPAPYVVGFSDDAARMLGLEPALRDAPGFAEL
    FCGNPTRDWPQASLPYASVYSGHQFGVWAGQLGDGRALTIGELAHDGRRYELQLKGAGRTPYSRMGDGRAVLRSSIREFL
    CSEAMHHLGIPTTRALAVIGSDQPVVREEIETSAVVTRVAQSFVRFGHFEHFFANDRPEQLRALADHVIERFYPACRDAD
    DPYLALLAEATRRTAELVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFIDAFDAKHVCNHSDTQGRYAYRMQPRIAHW
    NCFCLAQALLPLIGLHRDAPSEDARAERAVEDAHAVLGRFPEQFGPALERAIRAKLGLALEREGDAALANQLLEIMDASH
    ADFTLTFRHLARVSKHDARGDAPVRDLFIDRDAFDRWANLYRARLSEEARDDASRAAAMNRVNPKYVLRNHLAETAIRRA
    KEKDFSEVERLAAVLRRPFDEQPEHDAYAALPPDWASTLEVS
    CSS

    >gi|126449012|ref|YP_001080759.1| methionine-R-sulfoxide reductase [Burkholderia mallei NCTC 10247]
    MNSSGESKMSGDRDDPRYPYPKDDAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCGTALFESGAKFHSG
    CGWPSYFKPIDGEVIDEKMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEAKPERK

    >gi|126450166|ref|YP_001080806.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10247]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEILR
    ILDGLQTDELCPCNRAIGGATL

    >gi|126448306|ref|YP_001080893.1| hypothetical protein BMA10247_1342 [Burkholderia mallei NCTC 10247]
    MAGAKAAAGTVVYGIPNCDTVKKARTWLESHGVEFAFHDFKKAGVSAPLVKGWLADVPLDALVNRRGTTWRALTDEQKAA
    AESEAGAIALMIDKPSVIKRPVVVVDGRVKALGFSADEYAGLFA

    >gi|126450623|ref|YP_001080897.1| glutathione peroxidase [Burkholderia mallei NCTC 10247]
    MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVLGFPCNQFGKQEPGDASQIGA
    FCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGLKAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL

    >gi|126448283|ref|YP_001081034.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC 10247]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDELTPEDQMFESHGVKVFVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|126449081|ref|YP_001081047.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10247]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEIKIKAGDKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKPAAAAPAPAAAPAPAPQAGSSSGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTALVVEEAQALASHGITFGKPQVELDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPY
    HMEVQGENGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAQAKEDGIYVTFEGEKAPAQAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|126450435|ref|YP_001081331.1| hypothetical protein BMA10247_1792 [Burkholderia mallei NCTC 10247]
    MSAAVRFTLYGRGWCHLCDEMRDALAPVAAECSASVDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDEARVRGALA
    RRGA

    >gi|126448959|ref|YP_001081469.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10247]
    MSLRLGDIAPDFEQDSSLGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKGEFEKRNVKVIALSVDSVESHKGW
    IDDINETQATSVGFPIIADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DHYKVATPGNWKDGDDVVIVPSLQDPDELKQRFPKGFKAVRPYLRLTPQPNK

    >gi|126449443|ref|YP_001081523.1| thioredoxin-disulfide reductase [Burkholderia mallei NCTC 10247]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADADGVQGPELMQRFLAHAQRFNTEI
    VFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYLGLQSEEAFMGRGVSA
    CATCDGFFYRGQNVAVVGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILVDRLLEKEKEGAVEIKWDHVLDEVTGDDSGVSGVRIKHVTTGATEDVAVQGLF
    IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDHK


    >gi|126451176|ref|YP_001081576.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10247]
    MQILSASALAEWLRDPARPAPIVLDVREPWEIATAKIDGSVSIPMQQIPARSEELDDEAAIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPAVPRY

    >gi|126449001|ref|YP_001081751.1| glutathione-disulfide reductase [Burkholderia mallei NCTC 10247]
    MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLRGCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSW
    PTLIEAKDREIARLSGIYVDLLNKSGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREAL
    ELPELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGVAIHTRATIEAIERGADGG
    LTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDANGAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLL
    AANLFGGKRIAADHRYVPSAVFSQPEIATVGLTEAQARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVVG
    AHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA

    >gi|126447967|ref|YP_001081817.1| thiol:disulfide interchange protein DsbA [Burkholderia mallei NCTC 10247]
    MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIA
    FKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVK
    QSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL

    >gi|126448808|ref|YP_001081828.1| regulatory protein ada (regulatory protein of adaptative response) [Burkholderia mallei NCTC 10247]
    MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRE
    LDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPER
    IAPFIAQIDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA

    >gi|126451216|ref|YP_001081851.1| ADA regulatory protein [Burkholderia mallei NCTC 10247]
    MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRE
    LDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPER
    IAPFIAQIDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA

    >gi|126451311|ref|YP_001081876.1| hypothetical protein BMA10247_2349 [Burkholderia mallei NCTC 10247]
    MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDRLADTHPGACFAWIDVETHADRLDELDVENFPTLLI
    EDANAVRFFGTVLPHAAIVERMLADLTALPGAPHAPKLRNLFD

    >gi|126448275|ref|YP_001082002.1| 4-carboxymuconolactone decarboxylase family protein [Burkholderia mallei NCTC 10247]
    MALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDDCIGFHVQTLVKLGTT
    REEFEDLLATAVYMGGGPSMMYAA

    >gi|126451422|ref|YP_001082047.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei NCTC 10247]
    MNAVTESAATTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLNKNGVVLLVD
    AMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|126449255|ref|YP_001082133.1| OsmC/Ohr family protein [Burkholderia mallei NCTC 10247]
    MGQDGMAFAAQTGSGHLVTMDGAPEGGGNNLAPRPMEMVLVGTGGCTAYDVVLILKKSRQEVIGCSVTLQAERASEDPKV
    FTKIHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELSHSFEIVAA

    >gi|126450848|ref|YP_001082266.1| stringent starvation protein A [Burkholderia mallei NCTC 10247]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|126448988|ref|YP_001082340.1| hypothetical protein BMA10247_2819 [Burkholderia mallei NCTC 10247]
    MSPAPAPTSRRAGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEATFTLLSGQKLSTAADLKGKVYLVNFWATSCATCMQE
    MPQMVDTYNRFKGRGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGA
    PQFAELDQLLQKALDTSA

    >gi|126449606|ref|YP_001082357.1| HesA/MoeB/ThiF family protein [Burkholderia mallei NCTC 10247]
    MNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAAAGVGTITLVDADTVDLTNLQRQILHATDSVG
    RKKVESGRDALARLNPDVKVNAVAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVAHRVPLVSGAALRFDGQIST
    FDFREPGSPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGATLVGRLMMLDSLRMEWNTMKIARQ
    PDCPVCGAGGAH

    >gi|126448708|ref|YP_001082360.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10247]
    MTFFTDYTNLALIAILVVSGSLLAWPALRRGGGGLSAAEATQLINRRNALVVDLRPAAEYGAGHLPSARSVEFGELQAKA
    GQLAKNKATPVLLV
    CQNGQQSQKARKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK

    >gi|126449161|ref|YP_001082361.1| glutaredoxin 3 [Burkholderia mallei NCTC 10247]
    MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLK
    PLLEAA

    >gi|126450084|ref|YP_001082756.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10247]
    MGRVVCRERPYRYEGPGMIQVGDTLPDAQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQHVPGY
    VAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSRRYAMVVDDGVV
    KTLFVEAPGKFEVSDAASVLAGLTR

    >gi|126449268|ref|YP_001082795.1| thiol peroxidase [Burkholderia mallei NCTC 10247]
    MSKVTLGGNPIDIAGTFPTVGSPAPDFKLVGKDLADVSLATFAGKRKVLNIVPSLDTPTCAASTRKFNEAASKLDNTVVV
    VVSADLPFAATRFCTTEGLANVITASTFRGGRAFADAYGVNVTSGPLDGLAARAVIVIDENDKVTYTELVGEIKNEPNYD
    AALAALK

    >gi|126448639|ref|YP_001082801.1| putative thioredoxin family protein [Burkholderia mallei NCTC 10247]
    MNSKGIFAGIVVAAVAVAGGLAAGHWMRGNPASGPQAGTPAAPPAAGNPVDTLWAASYPDVDGKPQRLAAFKGQKLVVNF
    WASW
    CGPCVEEMPELVKLSREYEKKGVRFVGIGVDSDQNVKNFLKKVPVDYPIVVSGYAGADLARHFGNTAGALPFTVVI
    DETGKIRETKLGQIRPDELKRTLDTL

    >gi|126449092|ref|YP_001083019.1| putative thiol:disulfide interchange protein DsbD [Burkholderia mallei NCTC 10247]
    MFNRIPRHAQSRFRFLIAVVAMLGVLFGTSLAARAADDFLDPAVAFKFSASEAPGQVDVHFKIADGYYMYRERFAFAVKS
    GSATLGEPQLPAGHVKFDPTFQKNVETYRGDLTIHLPIKQASGPFELAVTSQGCADEGICYPPAEHVARIEGAALGAAGT
    APAAAGAGADTSAADGGSWYERVTSADYARSLLEGHGFLTIVALYFVAGMVLSLLPCSYPMIPILSAIIVGEGARATRAR
    AFALSLTYVIGMALVYTALGVAAALVGQSLGAWLQNPWVLGAFALLLTVFALLLIGGVDITLPQRWQNGAAQTSGPRKGG
    RFAAVATMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFSMGIGLGVPLLVIGIGAGTLLPRAGAWMDGVKVFF
    GVLLLAAALWIVWPVLNAASQLGLGALWLLIAAAALGLFTPHSGSSSVWRRLGRGLGAALAIWAATLLVGLAAGSTDPLR
    PLAVLAARAAPNNGPAGAGAGAHEGPAFAPVRSIAELDEIVKTSTRPVMLDFYADW
    CVSCKEMEHLTFTDARVGARLSQM
    HLVRADVTANSPDDQALLKRFGLFGPPGIIVFDANGQERGRVVGYQSADRFLRSLDRMSLPAAWSAS

    >gi|126450205|ref|YP_001079900.1| rhodanese superfamily protein [Burkholderia mallei NCTC 10247]
    MTTVNLAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLFEGKFADLPFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDQGHDDAGRPVVMLDTRNAFEVDVGTFDRALDYRI
    DKFSEFPAVIEANRADLEGKTIVSF
    CTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLAPTADVTCFACRAVVPADAQQSPLYVPGKCCPACHPGDSGTPGRRAEPGAEPARAV

    >gi|126451281|ref|YP_001082381.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10247]
    MLKTLFARRRAQRGWLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHC
    PDV
    CPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQLKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDPNGKLRLFVRDGQGPGPWVHDLKLLLD