Burkholderia mallei NCTC 10229 uid58383

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124382925|ref|YP_001023880.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10229]
    MSHVTEIPAADSAAAVAHFAASLAFETDCRDVHDALACGAPDFVLLDVRGPEQYAAAHVPGALNLPHRKIIESKLSEFAR
    DTCFVVY
    CAGPHCNGAARAALRLARLGRPVKLMLGGVTGWLDEGFALARGNGASRRQGGLRQRTAGNDPLRNRNN

    >gi|124382895|ref|YP_001024020.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10229]
    MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVATGHARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRN
    PRFVRELEAKTGKDAVVLLL
    CRSGNRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS

    >gi|124383305|ref|YP_001024028.1| YeeE/YedE family protein [Burkholderia mallei NCTC 10229]
    MAVDFVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLLAGGRSDAGWRAAFLVGLIAAAVAANALDWFSMPAV
    DAGWARVIAGGVLVGIGTRYAGG
    CTSGHGVCGISRGAPRSIVATAVFMAAGIATVFVLRHVVGG

    >gi|124381550|ref|YP_001024382.1| pyridine nucleotide-disulphide oxidoreductase, class II, truncation [Burkholderia mallei NCTC 10229]
    MNFDVVIIGGSFAGQAAALQLARARRGVLLIDAKRPRNRFARTSHGFLGQDGHAPSAINATAGRQLAAYPTVQFDAGDAI
    DAAAVSDGFRVSLADGRQAQGRRLILATGVRDILPALPGLQERWGVSVLH
    CPYCHGYELERRPMGVLASSEQAVHQAMLV
    SDWGPTTLFTQGAFVPTREQSAMLSARGVTVEQTPVAALVGAAPALEAVCLADGRTAALCGLFIAPRTVPACDLPERLGC
    VFDDGPTGPYLSVDERQQTSVPGVFAAGGCRAADGECDVGRRRGRDRGSGRASFADLWCGRARLTDGGGDAGHTGAGGAR
    AGPHRRPAMPPCGRLFELPGEPQQDRVNRQFEAG

    >gi|124383180|ref|YP_001024567.1| dedA family protein [Burkholderia mallei NCTC 10229]
    MPIHAAHAPRRASRLSAAPMPPGSAFVAFEVRFVWHFPQAVPASLGPWAVFASVLVTQLGMPVPAVPMLIVGGTMAAMGQ
    ASYASMLVAAVAATVLADSMWFFAGRARGRRLLNALVRFSLSLDTTLRIARKVFEKHGAPLLVLAKFLPGLGLVSAPLLG
    TTAVAVWVFLFWDVAGASLWASVWLFGGAALHDEIVRLMQWVSASGGTLFDAFAAIFVTFLLYRWAMRMRFRRWLAKIRI
    SPQQLDAMLKSAAPPIVFDARPRAVREKEAYRIAGAYPLDLDSPDPLHPDLMTRPIVVYCV
    CPNEATAKRIVSQLQRKRI
    RHALALKGGLDAWEKHGYPVEPLPADFDAARYAAPPPVERIAPLEPGGRDGGYPMRAGLTD

    >gi|124381899|ref|YP_001024757.1| putative thiol:disulfide interchange protein DsbC [Burkholderia mallei NCTC 10229]
    MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEVNLGSQIVYSDASGDYVLLGE
    LVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STVKSKSIWCASDRVKSWQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
    VK

    >gi|124383089|ref|YP_001024783.1| glutaredoxin-related protein [Burkholderia mallei NCTC 10229]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFTA

    >gi|124381840|ref|YP_001024879.1| alkyl hydroperoxide reductase, subunit C [Burkholderia mallei NCTC 10229]
    MPIINSPIKPFKATAYHNGDFVQVSDETLKGKWSVVVFYPADFTFVCPTELGDLAERYAEFQKLGVEIYAVSTDTHFTHK
    AWHDTSDTIAKIKYPMIGDPTLAISRNFDVLIEEEGLALRGTFVINPQGEIKLCEIHDNGIGRDAGELLRKVQAAQYAAA
    HPGEVCPAKWTPGADTLTPSLDLIGKI

    >gi|124381662|ref|YP_001024947.1| copper-translocating P-type ATPase [Burkholderia mallei NCTC 10229]
    MQMTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAVADLAAGTATVAAASAIDTARLVAALDAAGYRATVA
    TAPAATGNADARHGRARDEDDDAAAAPHTAAVTLTIGGMT
    CGGCARRVEQALAAVRGVADAKVDLATTSAKASVARDVDS
    QTLVAAVEQAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQSFEFDIAGMT
    CASCVGRV
    EKALAQVPGVVRATVNLATEKAAVDADADAHVDTARLIDAVKRAGYRASPVSDTASALAPSPEIAAARTAIELDIAGMT
    C
    ASCVGRVEKALAQVPGVARATVNLATEKATVDADADAHVDTARLIDAVKRAGYRASPAIAACAPASRATATADAAAARPA
    SPSADDRKLAEARRERALVIASAVLTTPLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMD
    LLVALGTSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPDRARIVEHGVERDV
    PLAQVRVGTVVRVLPGERVPVDGRIEAGVTHVDESLITGESLPVPKEPGERVTAGSINGEGALTVATTAIGAETTLARII
    RLVESAQAEKAPIQRLVDRVSAVFVPAIVAIAFATFAGWLVAGAGVETAILNAVAVLVIACPCALGLATPAAIMAGTGVA
    ARHGVLIKDAQALELAQRARIVAFDKTGTLTQGRPTVTAFDAIGIPRGDALALAAAVQRASAHPLARAVVAAFDADADAR
    RSSLAAAHADTPRAVAGRGVEARVDARLLALGSTRWRDELGIAVPDGVARRAAALEAAGNTVSWLMRADAPREALALVAF
    GDTVKPNARRAIERLAARGIRSALVTGDNRGSATAVAASLGIDEVHAQVLPDDKARVVAQLKATAGDGAVAMVGDGINDA
    PALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAVDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAA
    MAFSSVSVVTNALLLRRWKGDAR

    >gi|124381655|ref|YP_001025121.1| dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10229]
    MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAGEFDKVRGFAGDSPLGIRTQA
    PAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDARVVDGKTVDVDTGGGARVRIQ
    CEHLLLAAGSEPVELPAMPF
    GGNVISSTGALSPGRLPKRLVVVGAGYIGLELGIAYRKLGVEVSVVEARERILPIYDAELTKPVAASLKRLGVRVLLGHK
    VLGLNARGDAVCVQDDAHAQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKVDDMCRTSMRNVWAIGDLTGEPML
    AHRAMAQGEMVAEIVAGKKRHFMPAAIAAICFTDPEVVSAGLAPDEAERTFGACVSASFPFAANGRALTLESADGFVRVV
    ARRDDHLIVGWQAVGAGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI

    >gi|124381635|ref|YP_001025135.1| pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia mallei NCTC 10229]
    MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGV
    RAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEI
    AATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
    VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVS
    IFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDP
    NYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
    YESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETG
    EPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVE
    VMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
    YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA

    >gi|124383052|ref|YP_001025166.1| putative lipoprotein [Burkholderia mallei NCTC 10229]
    MKTAIRKLTASLLVAAAAACFAADAPHAPEHLPPGIAWRQGDVDAAFAEAKRTNKPLFLYWGAVWCPSCNQVKSTIFSQQ
    AFKSRSSFFVPVYLDGDTENAQKIGDRFKVRGYPTMILFRPDGTELTRLPGEVDLDRYMQALSIGLNASHPFKRTLAAAL
    KDGARVTPDEWRVLADYSWDTDGDLPVPGERVAATLQALARHARADHANAQALRLDLKAAVSAAAGDPPQQGDVDKAAAA
    AAVRDALRDPKRARADYDVLVAAPAEVVAYLAGGDAAARALLAKQYDAALARLSTDASLAAIDRTMALHGRVRVARLDAR
    PGAPLPPALADAVRRQTASAVTESTNVYGRQAVVSEAADTLTDAGQFDAADALLKAELVRSPTPYYFMSGLAANAKARGD
    RAAALDWYRKAYEAASGSATRLRWGAAYFANAVDLAPDDAAQIRRIANDVLTQASQTRNAFYGANRRALTRVVTQLARWR
    QRGAHDAAAQAVVKQFEGVCGKLPVGDPQVGTCEGLLKTAKA

    >gi|124381452|ref|YP_001025223.1| arsenate reductase [Burkholderia mallei NCTC 10229]
    MITIYHNPRCSKSRETLALVETLNPTGEAINVVEYLKQPLTAAQLKVLHRQLGRPVRDMIRDNEAPYKDLNLADAALSDT
    QLYDAIAEHPILLQRPIVVHGDKAAIGRPPEAVRSLFE

    >gi|124382692|ref|YP_001025419.1| hypothetical protein BMA10229_1619 [Burkholderia mallei NCTC 10229]
    MPLIHATAEMAPDAPNYVVELEAGKHRLQGDENEHEGGGNVGPAPYELVLSGLAACTVATLRMYMQRKAWPAARLLARAE
    LHVDREGAQYVRRTIVVDGAQRTRLAEIAEKTPVTLFVKRGTRIETTLK

    >gi|124383086|ref|YP_001025478.1| organic hydroperoxide resistance protein [Burkholderia mallei NCTC 10229]
    MNILYKTAATSTGGRDGRATSHDQKLDMKLSAPRELGGAGAEGTNPEQLFAAGYSACFLSAMKFAAGQNKQTLPADTTVT
    AEVGIGPNEEGGFALDVELRVALPGLDAAAAKTLVDRAHHV
    CPYSNATRNNVAVRLVVA

    >gi|124382393|ref|YP_001025500.1| rhodanese domain-containing protein [Burkholderia mallei NCTC 10229]
    MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTDLGEQAYAAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDA
    LVDTLKAHGLRQNQQIVAYDAQGGMYAARLWWLLRWLGHDSVAVLDGGLQAWQSEGHAVSQDTPPKSMGDFRAGAPLATV
    VDAQTVLANLATKDRLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTADGRFKSGHELREAFSPLLGATEPKKV
    ILQ
    CGSGVTACHNALAMEIAGLHDPALYAGSWSEWSADPSRPVATGANP

    >gi|124381523|ref|YP_001025529.1| dedA family protein [Burkholderia mallei NCTC 10229]
    MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPDALGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRA
    LKTLCKLSLSRDSCVKKTERFFGRWGVRVLAVARFIPGLSLISVPMAGALGTRYRVFVGYDGLGALLWAGCGVAIGFAFA
    KQIDWLFAGANQLGRAVLVVIVALLAVYTAVRWMRRRALIRQLANARIDVDELERLLRAEPAPVVFDARSPEHRKLDPYA
    IPGAQFADERDLRDIVAHYPATQKFVIYCS
    CPNEVSAALMAQRLKQAGFADALALRGGLDAWRDTGRQLIELAPQPPSEA
    PVLAAAPKTA

    >gi|124383174|ref|YP_001025556.1| ArsR family transcriptional regulator [Burkholderia mallei NCTC 10229]
    MSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERSVEDLTALSGMSFANTSRHLQILRRARLVDTERRGKNVVYRL
    AGDSEVVGLMKALGRLGERNVAEVNRVLGDYFHARDSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGALNIPLA
    ALEARLSELPADTEIVAY
    CRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGFVVETEPAN

    >gi|124381745|ref|YP_001025928.1| selenophosphate synthetase [Burkholderia mallei NCTC 10229]
    MAMTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMP
    IVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLA
    ALGVVHPARVKRNAAARAGDVLVLGKPLGVGVLSTALKKDRLDAQGYAQMIATTTKLNRPGTALAALPGVHALTDVTGFG
    LLGHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASGRNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVAC
    APEAVDDVLACFRDDGFERAAAIGEMVDGAARVDVS

    >gi|124385854|ref|YP_001026021.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10229]
    MSVEVDRQVPDFTAPATGGEFSLSGIKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHENFK
    AKLELPFLLISDPDETLCALFGVMKLKKMYGKEVRGIERSTFLIDGAGMLRHAWRGVKVPGHVDDVLSAVQAL

    >gi|124384408|ref|YP_001026053.1| thioredoxin [Burkholderia mallei NCTC 10229]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|124385122|ref|YP_001026169.1| dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10229]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENAQHHLADHGIS
    VDGVKMDVAKMLARKDGIVEKMTGGIEFLFKKNKITWLKGHGKFTGKSDAGVQIEVSGEGETQVVTAKNVIIATGSKARH
    LSNVPVDNKIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIDGVKTGANGVSIAYTDKDGNAKTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|124385008|ref|YP_001026801.1| carboxymuconolactone decarboxylase family protein [Burkholderia mallei NCTC 10229]
    MAHAPRLPYPKLASKPFNALLHLSETVWGGSLGKPLVDLVFLRVSQINGCAYCIDMHWRDLVKLGVNERHLNAVAGWREA
    PFFDARERAALQWAESVARIPHTDPSDEAFAQLQAHFSDAEIAELGFAIATINAWNLLNVSFRNPIPETV

    >gi|124384947|ref|YP_001026965.1| disulfide bond formation protein B [Burkholderia mallei NCTC 10229]
    MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFIGAGMASGAGVAVTEALIVLS
    AAAGVGTAARHLYVQLNPGFS
    CGFDALQPVVDSLPPARWLPGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVS
    LLRHRGRLR

    >gi|124384812|ref|YP_001027102.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei NCTC 10229]
    MNAVTESAATTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLNKNGVVLLVD
    AMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|124386207|ref|YP_001027182.1| OsmC/Ohr family protein [Burkholderia mallei NCTC 10229]
    MPNHNRIKQRWSSRMECKVSWMGQDGMAFAAQTGSGHLVTMDGAPEGGGNNLAPRPMEMVLVGTGGCTAYDVVLILKKSR
    QEVIGCSVTLQAERASEDPKVFTKIHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELSHSFEIVAA

    >gi|124383422|ref|YP_001027263.1| putative thioredoxin family protein [Burkholderia mallei NCTC 10229]
    MNSKGIFAGIVVAAVAVAGGLAAGHWMRGNPASGPQAGTPAAPPAAGNPVDTLWAASYPDVDGKPQRLAAFKGQKLVVNF
    WASW
    CGPCVEEMPELVKLSREYEKKGVRFVGIGVDSDQNVKNFLKKVPVDYPIVVSGYAGADLARHFGNTAGALPFTVVI
    DETGKIRETKLGQIRPDELKRTLDTL

    >gi|124385207|ref|YP_001027269.1| thiol peroxidase [Burkholderia mallei NCTC 10229]
    MSKVTLGGNPIDIAGTFPTVGSPAPDFKLVGKDLADVSLATFAGKRKVLNIVPSLDTPTCAASTRKFNEAASKLDNTVVV
    VVSADLPFAATRFCTTEGLANVITASTFRGGRAFADAYGVNVTSGPLDGLAARAVIVIDENDKVTYTELVGEIKNEPNYD
    AALAALK

    >gi|124385055|ref|YP_001027307.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10229]
    MREAGLGRVVCRERPYRYEGPGMIQVGDTLPDAQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQ
    HVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSRRYAMVV
    DDGVVKTLFVEAPGKFEVSDAASVLAGLTR

    >gi|124386626|ref|YP_001027376.1| hypothetical protein BMA10229_A1393 [Burkholderia mallei NCTC 10229]
    MSPAPAPTSRRAGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEATFTLLSGQKLSTAADLKGKVYLVNFWATSCATCMQE
    MPQMVDTYNRFKGRGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGA
    PQFAELDQLLQKALDTSA

    >gi|124385308|ref|YP_001027392.1| HesA/MoeB/ThiF family protein [Burkholderia mallei NCTC 10229]
    MNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAAAGVGTITLVDADTVDLTNLQRQILHATDSVG
    RKKVESGRDALARLNPDVKVNAVAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVAHRVPLVSGAALRFDGQIST
    FDFREPGSPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGATLVGRLMMLDSLRMEWNTMKIARQ
    PDCPVCGAGGAH

    >gi|124385788|ref|YP_001027395.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10229]
    MTFFTDYTNLALIAILVVSGSLLAWPALRRGGGGLSAAEATQLINRRNALVVDLRPAAEYGAGHLPSARSVEFGELQAKA
    GQLAKNKATPVLLV
    CQNGQQSQKARKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK

    >gi|124385782|ref|YP_001027396.1| glutaredoxin 3 [Burkholderia mallei NCTC 10229]
    MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLK
    PLLEAA

    >gi|124383627|ref|YP_001027787.1| stringent starvation protein A [Burkholderia mallei NCTC 10229]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|124384469|ref|YP_001027924.1| putative thiol:disulfide interchange protein DsbD [Burkholderia mallei NCTC 10229]
    MFNRIPRHAQSRFRFLIAVVAMLGVLFGTSLAARAADDFLDPAVAFKFSASEAPGQVDVHFKIADGYYMYRERFAFAVKS
    GSATLGEPQLPAGHVKFDPTFQKNVETYRGDLTIHLPIKQASGPFELAVTSQGCADEGICYPPAEHVARIEGAALGAAGT
    APAAAGAGADTSAADGGSWYERVTSADYARSLLEGHGFLTIVALYFVAGMVLSLLPCSYPMIPILSAIIVGEGARATRAR
    AFALSLTYVIGMALVYTALGVAAALVGQSLGAWLQNPWVLGAFALLLTVFALLLIGGVDITLPQRWQNGAAQTSGPRKGG
    RFAAVATMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFSMGIGLGVPLLVIGIGAGTLLPRAGAWMDGVKVFF
    GVLLLAAALWIVWPVLNAASQLGLGALWLLIAAAALGLFTPHSGSSSVWRRLGRGLGAALAIWAATLLVGLAAGSTDPLR
    PLAVLAARAAPNNGPAGAGAGAHEGPAFAPVRSIAELDEIVKTSTRPVMLDFYADW
    CVSCKEMEHLTFTDARVGARLSQM
    HLVRADVTANSPDDQALLKRFGLFGPPGIIVFDANGQERGRVVGYQSADRFLRSLDRMSLPAAWSAS

    >gi|124383563|ref|YP_001027964.1| thiol:disulfide interchange protein DsbA [Burkholderia mallei NCTC 10229]
    MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIA
    FKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVK
    QSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL

    >gi|124384212|ref|YP_001028027.1| glutathione-disulfide reductase [Burkholderia mallei NCTC 10229]
    MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLRGCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSW
    PTLIEAKDREIARLSGIYVDLLNKSGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREAL
    ELPELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGVAIHTRATIEAIERGADGG
    LTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDANGAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLL
    AANLFGGKRIAADHRYVPSAVFSQPEIATVGLTEAQARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVVG
    AHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA

    >gi|124386050|ref|YP_001028196.1| 4-carboxymuconolactone decarboxylase family protein [Burkholderia mallei NCTC 10229]
    MALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDDCIGFHVQTLVKLGTT
    REEFEDLLATAVYMGGGPSMMYAA

    >gi|124386627|ref|YP_001028213.1| ADA regulatory protein [Burkholderia mallei NCTC 10229]
    MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRE
    LDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPER
    IAPFIAQIDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA

    >gi|124384500|ref|YP_001028235.1| hypothetical protein BMA10229_A2272 [Burkholderia mallei NCTC 10229]
    MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDRLADTHPGACFAWIDVETHADRLDELDVENFPTLLI
    EDANAVRFFGTVLPHAAIVERMLADLTALPGAPHAPKLRNLFD

    >gi|124383367|ref|YP_001028449.1| peptide methionine sulfoxide reductase [Burkholderia mallei NCTC 10229]
    MSEATSEVATLGGGCFWCQEAVFLDVDGVTAVESGYAGGHTRNPGYRDVCDGDTGHAEVVSVSFDPARIGYREILEIFFA
    THDPTQLNRQGNDVGTQYRSVIFTHSDAQRDAALELIRTLERDKLYDDPIVTQVEPLNGNYWPAEAYHQNYYARNPGQGY
    CAVVIGPKLAKFRQKFAHRLKSRGA

    >gi|124386650|ref|YP_001028455.1| thioredoxin [Burkholderia mallei NCTC 10229]
    MKKRPRSPIVHTSNIDEDAMDTTLATFERDVIEASLAAPVLVDFWAPWCGPCKTLGPLLEKLEQEYEGR

    >gi|124386345|ref|YP_001028461.1| methylated-DNA-protein-cysteine methyltransferase [Burkholderia mallei NCTC 10229]
    MTVWRAAGVALRAPLQERTMFNAVIDAPFGKVGIRTDASVVREIVYLPESIKRVAPGTPLAKQAARQIELYFERASARFD
    LPLAEVGTPFQHRVWHAICAIPPGVVLTYGQIAKQIGSAPRAVGQACGANYFPLVIP
    CHRVVASGGLGGFANHDDEGYFL
    KVKRWLLAHEGVRY

    >gi|124384565|ref|YP_001028526.1| rhodanese-like domain-containing protein [Burkholderia mallei NCTC 10229]
    MQILSASALAEWLRDPARPAPIVLDVREPWEIATAKIDGSVSIPMQQIPARSEELDDEAAIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPAVPRY

    >gi|124384546|ref|YP_001028578.1| thioredoxin-disulfide reductase [Burkholderia mallei NCTC 10229]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADADGVQGPELMQRFLAHAQRFNTEI
    VFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYLGLQSEEAFMGRGVSA
    CATCDGFFYRGQNVAVVGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILVDRLLEKEKEGAVEIKWDHVLDEVTGDDSGVSGVRIKHVTTGATEDVAVQGLF
    IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDHK


    >gi|124384211|ref|YP_001028629.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10229]
    MSLRLGDIAPDFEQDSSLGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKGEFEKRNVKVIALSVDSVESHKGW
    IDDINETQATSVGFPIIADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DHYKVATPGNWKDGDDVVIVPSLQDPDELKQRFPKGFKAVRPYLRLTPQPNK

    >gi|124385609|ref|YP_001028761.1| hypothetical protein BMA10229_A2812 [Burkholderia mallei NCTC 10229]
    MSAAVRFTLYGRGWCHLCDEMRDALAPVAAECSASVDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDEARVRGALA
    RRGA

    >gi|124385266|ref|YP_001029033.1| pyruvate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Burkholderia mallei NCTC 10229]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEIKIKAGDKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKPAAAAPAPAAAPAPAPQAGSSSGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTALVVEEAQALASHGITFGKPQVELDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPY
    HMEVQGENGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAQAKEDGIYVTFEGEKAPAQAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|124384395|ref|YP_001029046.1| iron-sulfur cluster assembly protein IscA [Burkholderia mallei NCTC 10229]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDELTPEDQMFESHGVKVFVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|124385460|ref|YP_001029174.1| glutathione peroxidase [Burkholderia mallei NCTC 10229]
    MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVLGFPCNQFGKQEPGDASQIGA
    FCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGLKAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL

    >gi|124384356|ref|YP_001029178.1| hypothetical protein BMA10229_A3242 [Burkholderia mallei NCTC 10229]
    MAGAKAAAGTVVYGIPNCDTVKKARTWLESHGVEFAFHDFKKAGVSAPLVKGWLADVPLDALVNRRGTTWRALTDEQKAA
    AESEAGAIALMIDKPSVIKRPVVVVDGRVKALGFSADEYAGLFA

    >gi|124385671|ref|YP_001029259.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei NCTC 10229]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEILR
    ILDGLQTDELCPCNRAIGGATL

    >gi|124385040|ref|YP_001029305.1| methionine-R-sulfoxide reductase [Burkholderia mallei NCTC 10229]
    MSGDRDDPRYPYPKDDAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCGTALFESGAKFHSGCGWPSYFK
    PIDGEVIDEKMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEAKPERK

    >gi|124384298|ref|YP_001029306.1| hypothetical protein BMA10229_A3374 [Burkholderia mallei NCTC 10229]
    MSFSRSEAAPAAPLPDLAATLAAPRDDAFQQLGAAFVTRLPAAPLPAPYVVGFSDDAARMLGLEPALRDAPGFAELFCGN
    PTRDWPQASLPYASVYSGHQFGVWAGQLGDGRALTIGELAHDGRRYELQLKGAGRTPYSRMGDGRAVLRSSIREFLCSEA
    MHHLGIPTTRALAVIGSDQPVVREEIETSAVVTRVAQSFVRFGHFEHFFANDRPEQLRALADHVIERFYPACRDADDPYL
    ALLAEATRRTAELVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFIDAFDAKHVCNHSDTQGRYAYRMQPRIAHWNCFC
    LAQALLPLIGLHRDAPSEDARAERAVEDAHAVLGRFPEQFGPALERAIRAKLGLALEREGDAALANQLLEIMDASHADFT
    LTFRHLARVSKHDARGDAPVRDLFIDRDAFDRWANLYRARLSEEARDDASRAAAMNRVNPKYVLRNHLAETAIRRAKEKD
    FSEVERLAAVLRRPFDEQPEHDAYAALPPDWASTLEVS
    CSS

    >gi|124385632|ref|YP_001026816.1| rhodanese superfamily protein [Burkholderia mallei NCTC 10229]
    MTTVNLAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLFEGKFADLPFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDQGHDDAGRPVVMLDTRNAFEVDVGTFDRALDYRI
    DKFSEFPAVIEANRADLEGKTIVSF
    CTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLAPTADVTCFACRAVVPADAQQSPLYVPGKCCPACHPGDSGTPGRRAEPGAEPARAV

    >gi|124385576|ref|YP_001027416.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10229]
    MLKTLFARRRAQRGWLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHC
    PDV
    CPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQLKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDPNGKLRLFVRDGQGPGPWVHDLKLLLD