Burkholderia mallei ATCC 23344 uid57725

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|53724905|ref|YP_101867.1| carboxymuconolactone decarboxylase family protein [Burkholderia mallei ATCC 23344]
    MALPQSYRELTGEVATQMRALRKTQPDLMSAFAALAAAGTKEGALGKKTRELVALGIAIASRCDDCIGFHVQTLVKLGTT
    REEFEDLLATAVYMGGGPSMMYAA

    >gi|53724625|ref|YP_101932.1| thiol:disulfide interchange protein DsbA [Burkholderia mallei ATCC 23344]
    MKKLLSSLFLSLSLVAGFAQASPSAPVAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGDKIA
    FKRVPVAFRDDFVPHSKLFYALAALGVSEKVTPAVFNAIHKEKNYLLTPQAQADFLATQGVDKKKFLDAYNSFSVQGQVK
    QSAELLKNYNIDGVPTIVVQGKYKTGPAYTNSLEGTAQVLDFLVKQVQDKKL

    >gi|53724651|ref|YP_101959.1| ADA regulatory protein [Burkholderia mallei ATCC 23344]
    MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRE
    LDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNS
    PSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPER
    IAPFIAQIDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIP
    C
    HRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA

    >gi|53724671|ref|YP_101980.1| hypothetical protein BMA0140 [Burkholderia mallei ATCC 23344]
    MPALNLDTDEGRIAERLRNPDTLLVACLCAEWCGTCREYRATFDRLADTHPGACFAWIDVETHADRLDELDVENFPTLLI
    EDANAVRFFGTVLPHAAIVERMLADLTALPGAPHAPKLRNLFD

    >gi|53725143|ref|YP_102174.1| peptide methionine sulfoxide reductase [Burkholderia mallei ATCC 23344]
    MSEATSEVATLGGGCFWCQEAVFLDVDGVTAVESGYAGGHTRNPGYRDVCDGDTGHAEVVSVSFDPARIGYREILEIFFA
    THDPTQLNRQGNDVGTQYRSVIFTHSDAQRDAALELIRTLERDKLYDDPIVTQVEPLNGNYWPAEAYHQNYYARNPGQGY
    CAVVIGPKLAKFRQKFAHRLKSRGA

    >gi|53725156|ref|YP_102185.1| methylated-DNA-protein-cysteine methyltransferase [Burkholderia mallei ATCC 23344]
    MFNAVIDAPFGKVGIRTDASVVREIVYLPESIKRVAPGTPLAKQAARQIELYFERASARFDLPLAEVGTPFQHRVWHAIC
    AIPPGVVLTYGQIAKQIGSAPRAVGQACGANYFPLVIP
    CHRVVASGGLGGFANHDDEGYFLKVKRWLLAHEGVRY

    >gi|53725188|ref|YP_102267.1| disulfide bond formation protein B [Burkholderia mallei ATCC 23344]
    MNNLTLSLRRERRLLVLLALVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFIGAGMASGAGVAVTEALIVLS
    AAAGVGTAARHLYVQLNPGFS
    CGFDALQPVVDSLPPARWLPGVFKVAGLCETVYPPIFGILLPGWALIAFVLIAVPVAVS
    LLRHRGRLR

    >gi|53725360|ref|YP_102336.1| hypothetical protein BMA0540 [Burkholderia mallei ATCC 23344]
    MSAAVRFTLYGRGWCHLCDEMRDALAPVAAECSASVDYVDIDADPALVARYDEDVPVLLLDGVEVCRHRFDEARVRGALA
    RRGA

    >gi|53724836|ref|YP_102749.1| dihydrolipoamide dehydrogenase [Burkholderia mallei ATCC 23344]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENAQHHLADHGIS
    VDGVKMDVAKMLARKDGIVEKMTGGIEFLFKKNKITWLKGHGKFTGKSDAGVQIEVSGEGETQVVTAKNVIIATGSKARH
    LSNVPVDNKIVADNEGALAFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIDGVKTGANGVSIAYTDKDGNAKTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|53723575|ref|YP_103023.1| thioredoxin [Burkholderia mallei ATCC 23344]
    MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQATPAKFGVRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|53723630|ref|YP_103051.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei ATCC 23344]
    MSVEVDRQVPDFTAPATGGEFSLSGIKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHENFK
    AKLELPFLLISDPDETLCALFGVMKLKKMYGKEVRGIERSTFLIDGAGMLRHAWRGVKVPGHVDDVLSAVQAL

    >gi|53723639|ref|YP_103092.1| hypothetical protein BMA1440 [Burkholderia mallei ATCC 23344]
    MGSNMSFSRSEAAPAAPLPDLAATLAALRDDAFQQLGAAFVTRLPAAPLPAPYVVGFSDDAARMLGLEPALRDAPGFAEL
    FCGNPTRDWPQASLPYASVYSGHQFGVWAGQLGDGRALTIGELAHDGRRYELQLKGAGRTPYSRMGDGRAVLRSSIREFL
    CSEAMHHLGIPTTRALAVIGSDQPVVREEIETSAVVTRVAQSFVRFGHFEHFFANDRPEQLRALADHVIERFYPACRDAD
    DPYLALLAEATRRTAELVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFIDAFDAKHVCNHSDTQGRYAYRMQPRIAHW
    NCFCLAQALLPLIGLHRDAPSEDARAERAVEDAHAVLGRFPEQFGPALERAIRAKLGLALEREGDAALANQLLEIMDASH
    ADFTLTFRHLARVSKHDARGDAPVRDLFIDRDAFDRWANLYRARLSEEARDDASRAAAMNRVNPKYVLRNHLAETAIRRA
    KEKDFSEVERLAAVLRRPFDEQPEHDAYAALPPDWASTLEVS
    CSS

    >gi|53723648|ref|YP_103093.1| methionine-R-sulfoxide reductase [Burkholderia mallei ATCC 23344]
    MSGDRDDPRYPYPKDDAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCGTALFESGAKFHSGCGWPSYFK
    PIDGEVIDEKMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEAKPERK

    >gi|53723646|ref|YP_103131.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei ATCC 23344]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLAKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEILR
    ILDGLQTDELCPCNRAIGGATL

    >gi|53723895|ref|YP_103207.1| hypothetical protein BMA1567 [Burkholderia mallei ATCC 23344]
    MAGAKAAAGTVVYGIPNCDTVKKARTWLESHGVEFAFHDFKKAGVSAPLVKGWLADVPLDALVNRRGTTWRALTDEQKAA
    AESEAGAIALMIDKPSVIKRPVVDGRVKALGFSADEYAGLFA

    >gi|53723899|ref|YP_103211.1| glutathione peroxidase [Burkholderia mallei ATCC 23344]
    MSKLYSFNAQALSGGEVPLEQYRGKVLLIVNTASECGFTPQYAGLQQLYDRFRERGLVVLGFPCNQFGKQEPGDASQIGA
    FCEKNYGVTFPMFGKIDVNGANAHPLYRYLTEEAPGILGLKAIKWNFTKFLVNREGEIVKRYAPSTKPEDIAADVEKLL

    >gi|53723801|ref|YP_103326.1| iron-sulfur cluster assembly accessory protein [Burkholderia mallei ATCC 23344]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDELTPEDQMFESHGVKVFVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|53723812|ref|YP_103339.1| pyruvate dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Burkholderia mallei ATCC 23344]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEIKIKAGDKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKPAAAAPAPAAAPAPAPQAGSSSGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTALVVEEAQALASHGITFGKPQVELDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPY
    HMEVQGENGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAQAKEDGIYVTFEGEKAPAQAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|53725464|ref|YP_103495.1| carboxymuconolactone decarboxylase family protein [Burkholderia mallei ATCC 23344]
    MAHAPRLPYPKLASKPFNALLHLSETVWGGSLGKPLVDLVFLRVSQINGCAYCIDMHWRDLVKLGVNERHLNAVAGWREA
    PFFDARERAALQWAESVARIPHTDPSDEAFAQLQAHFSDAEIAELGFAIATINAWNLLNVSFRNPIPETV

    >gi|53725605|ref|YP_103646.1| anti-oxidant AhpCTSA family protein [Burkholderia mallei ATCC 23344]
    MSLRLGDIAPDFEQDSSLGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKGEFEKRNVKVIALSVDSVESHKGW
    IDDINETQATSVGFPIIADGDRKVSELYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DHYKVATPGNWKDGDDVVIVPSLQDPDELKQRFPKGFKAVRPYLRLTPQPNK

    >gi|53725969|ref|YP_103694.1| thioredoxin-disulfide reductase [Burkholderia mallei ATCC 23344]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADADGVQGPELMQRFLAHAQRFNTEI
    VFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYLGLQSEEAFMGRGVSA
    CATCDGFFYRGQNVAVVGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILVDRLLEKEKEGAVEIKWDHVLDEVTGDDSGVSGVRIKHVTTGATEDVAVQGLF
    IAIGHKPNTDIFKGQLEMKDGYIITNSGLSGNATGTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDHK


    >gi|53726209|ref|YP_103902.1| iron-sulfur cluster insertion protein ErpA [Burkholderia mallei ATCC 23344]
    MNAVTESAATTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVLNKNGVVLLVD
    AMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|53725735|ref|YP_103973.1| OsmC/Ohr family protein [Burkholderia mallei ATCC 23344]
    MECKVSWMGQDGMAFAAQTGSGHLVTMDGAPEGGGNNLAPRPMEMVLVGTGGCTAYDVVLILKKSRQEVIGCSVTLQAER
    ASEDPKVFTKIHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELSHSFEIVAA

    >gi|53726121|ref|YP_104045.1| thioredoxin family protein, putative [Burkholderia mallei ATCC 23344]
    MNSKGIFAGIVVAAVAVAGGLAAGHWMRGNPASGPQAGTPAAPPAAGNPVDTLWAASYPDVDGKPQRLAAFKGQKLVVNF
    WASW
    CGPCVEEMPELVKLSREYEKKGVRFVGIGVDSDQNVKNFLKKVPVDYPIVVSGYAGADLARHFGNTAGALPFTVVI
    DETGKIRETKLGQIRPDELKRTLDTL

    >gi|53726106|ref|YP_104051.1| thiol peroxidase [Burkholderia mallei ATCC 23344]
    MSKVTLGGNPIDIAGTFPTVGSPAPDFKLVGKDLADVSLATFAGKRKVLNIVPSLDTPTCAASTRKFNEAASKLDNTVVV
    VVSADLPFAATRFCTTEGLANVITASTFRGGRAFADAYGVNVTSGPLDGLAARAVIVIDENDKVTYTELVGEIKNEPNYD
    AALAALK

    >gi|53726049|ref|YP_104087.1| AhpC/TSA family protein [Burkholderia mallei ATCC 23344]
    MTDETADDRPRRFATPGRVSRPLRMREAGLGRVVCRERPYRYEGPGMIQVGDTLPDAQLFEYLDDARAGCTLGPNAFGVR
    EQTAGKRVVIFGLPGAFTPT
    CSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTH
    ALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVEAPGKFEVSDAASVLAGLTR

    >gi|53723825|ref|YP_104137.1| thiol:disulfide interchange protein DsbD, putative [Burkholderia mallei ATCC 23344]
    MFNRIPRHAQSRFRFLIAVVAMLGVLFGTSLAARAADDFLDPAVAFKFSASEAPGQVDVHFKIADGYYMYRERFAFAVKS
    GSATLGEPQLPAGHVKFDPTFQKNVETYRGDLTIHLPIKQASGPFELAVTSQGCADEGICYPPAEHVARIEGAALGAAGT
    APAAAGAGADTSAADGGSWYERVTSADYARSLLEGHGFLTIVALYFVAGMVLSLLPCSYPMIPILSAIIVGEGARATRAR
    AFALSLTYVIGMALVYTALGVAAALVGQSLGAWLQNPWVLGAFALLLTVFALLLIGGVDITLPQRWQNGAAQTSGPRKGG
    RFAAVATMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFSMGIGLGVPLLVIGIGAGTLLPRAGAWMDGVKVFF
    GVLLLAAALWIVWPVLNAASQLGLGALWLLIAAAALGLFTPHSGSSSVWRRLGRGLGAALAIWAATLLVGLAAGSTDPLR
    PLAVLAARAAPNNGPAGAGAGAHEGPAFAPVRSIAELDEIVKTSTRPVMLDFYADW
    CVSCKEMEHLTFTDARVGARLSQM
    HLVRADVTANSPDDQALLKRFGLFGPPGIIVFDANGQERGRVVGYQSADRFLRSLDRMSLPAAWSAS

    >gi|53724247|ref|YP_104216.1| stringent starvation protein A [Burkholderia mallei ATCC 23344]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKSHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|53724508|ref|YP_104665.1| SCO1/SenC family protein [Burkholderia mallei ATCC 23344]
    MLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHCPDVCPTTMAELSQALQQLGPDGKR
    VQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQLKKVTKDFRVYYAKVPGKTPGSYTMDHTAASYVFDPNGKLR
    LFVRDGQGPGPWVHDLKLLLD

    >gi|53726096|ref|YP_104682.1| glutaredoxin 3 [Burkholderia mallei ATCC 23344]
    MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLK
    PLLEAA

    >gi|53724524|ref|YP_104683.1| rhodanese-like domain-containing protein [Burkholderia mallei ATCC 23344]
    MTFFTDYTNLALIAILVVSGSLLAWPALRRGGGGLSAAEATQLINRRNALVVDLRPAAEYGAGHLPSARSVEFGELQAKA
    GQLAKNKATPVLLV
    CQNGQQSQKARKIVEEAGYQDVHVLQGGVAAWQQAGMPVVK

    >gi|53724527|ref|YP_104686.1| molybdopterin biosynthesis protein MoeB [Burkholderia mallei ATCC 23344]
    MNDEQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAAAGVGTITLVDADTVDLTNLQRQILHATDSVG
    RKKVESGRDALARLNPDVKVNAVAERVDDAWLNAHVPHASVVLDCTDNFATRHAINRACVAHRVPLVSGAALRFDGQIST
    FDFREPGSPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGATLVGRLMMLDSLRMEWNTMKIARQ
    PDCPVCGAGGAH

    >gi|53724542|ref|YP_104701.1| hypothetical protein BMA3225 [Burkholderia mallei ATCC 23344]
    MSPAPAPTSRRAGPLRYVAIAVAAVAIAVAGYFAFNGKSSAPEATFTLLSGQKLSTAADLKGKVYLVNFWATSCATCMQE
    MPQMVDTYNRFKGRGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVIGKDGKILKRYVGA
    PQFAELDQLLQKALDTSA

    >gi|53724589|ref|YP_104823.1| glutathione-disulfide reductase [Burkholderia mallei ATCC 23344]
    MEFDYDLFVIGAGSGGVRLSRVAASYGARVGIAEEERIGGTCVLRGCIPKKLLVYASHYSHDVEDAAGYGWTFDIGLFSW
    PTLIEAKDREIARLSGIYVDLLNKSGVEIHTGRATLVGAHTVDVAGRRVTARHIAVATGSRPVLPPIPGIEHAITSREAL
    ELPELPQRIAIVGGGYIAVEFAGIFNGLGVDVDLFYRGEQILRGFDDDVRHALHGEMTKQGVAIHTRATIEAIERGADGG
    LTLRLAEGAYGPYDAVLYATGRVANGDGLGLEAVGVARDANGAIEVDAYSATTVPSIHAIGDVTARPQLTPVATRDGMLL
    AANLFGGKRIAADHRYVPSAVFSQPEIATVGLTEAQARAELGALDIYKTSFRALRHTLSGRDEKTFMKLVVARDSQRVVG
    AHMVGRDAAEIIQGIAIAIRAGATKAQFDETVGIHPTAAEEFVTLRQKEPDDA

    >gi|53716461|ref|YP_105060.1| hypothetical protein BMAA0240 [Burkholderia mallei ATCC 23344]
    MPLIHATAEMAPDAPNYVVELEAGKHRLQGDENEHEGGGNVGPAPYELVLSGLAACTVATLRMYMQRKAWPAARLLARAE
    LHVDREGAQYVRRTIVVDGALDGAQRTRLAEIAEKTPVTLFVKRGTRIETTLK

    >gi|53716644|ref|YP_105115.1| organic hydroperoxide resistance protein [Burkholderia mallei ATCC 23344]
    MNILYKTAATSTGGRDGRATSHDQKLDMKLSAPRELGGAGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTTVT
    AEVGIGPNEEGGFALDVELRVALPGLDAAAAKTLVDRAHHV
    CPYSNATRNNVAVRLVVA

    >gi|53716614|ref|YP_105132.1| rhodanese domain-containing protein [Burkholderia mallei ATCC 23344]
    MPHTHYTTLISADNLAERLAAAPGSVLVFDCRFDLADTDLGEQAYAAGHIPGAHYLHLDRDLSGAKTGTNGRHPLPARDA
    LVDTLKAHGLRQNQQIVAYDAQGGMYAARLWWLLRWLGHDSVAVLDGGLQAWQSEGHAVSQDTPPKSMGDFRAGAPLATV
    VDAQTVLANLATKDRLVIDARAADRYRGENETIDRVGGHIPGALNRFFKDNLTADGRFKSGHELREAFSPLLGATEPKKV
    ILQ
    CGSGVTACHNALAMEIAGLHDPALYAGSWSEWSADPSRPVATGANP

    >gi|53716401|ref|YP_105161.1| dedA family protein [Burkholderia mallei ATCC 23344]
    MLHDLVARFGPLIVFVNVLAAAIGLPVPAMPTLVLFGAMATLHPDALGAQLAPVLALAVLAALIGDTVWYVAGRHFGGRA
    LKTLCKLSLSRDSCVKKTERFFGRWGVRVLAVARFIPGLSLISVPMAGALGTRYRVFVGYDGLGALLWAGCGVAIGFAFA
    KQIDWLFAGANQLGRAVLVVIVALLAVYTAVRWMRRRALIRQLANARIDVDELERLLRAEPAPVVFDARSPEHRKLDPYA
    IPGAQFADERDLRDIVAHYPATQKFVIYCS
    CPNEVSAALMAQRLKQAGFADALALRGGLDAWRDTGRQLIELAPQPPSEA
    PVLAAAPKTA

    >gi|53716361|ref|YP_105181.1| ArsR family transcriptional regulator [Burkholderia mallei ATCC 23344]
    MSSAGPKQEIYESLAEVAQAVGHPNRLELLEHLAQRERSVEDLTALSGMSFANTSRHLQILRRARLVDTERRGKNVVYRL
    AGDSEVVGLMKALGRLGERNVAEVNRVLGDYFHARDSMEPVSRNELTARLADGLVTLLDVRPHDEFAQGHLPGALNIPLA
    ALEARLSELPADTEIVAY
    CRGPYCVLAFEAVAALRARGFKAARLEDGFPEWKAAGFVVETEPAN

    >gi|53717072|ref|YP_105273.1| glutaredoxin-related protein [Burkholderia mallei ATCC 23344]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFTA

    >gi|53717357|ref|YP_105293.1| putative thiol:disulfide interchange protein DsbC [Burkholderia mallei ATCC 23344]
    MICMKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEVNLGSQIVYSDASGDYVL
    LGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVL
    SPDSTVKSKSIWCASDRVKSWQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQA
    LAGVK

    >gi|53717336|ref|YP_105449.1| dedA family protein [Burkholderia mallei ATCC 23344]
    MWHFPQAVPASLGPWAVFASVLVTQLGMPVPAVPMLIVGGTMAAMGQASYASMLVAAVAATVLADSMWFFAGRARGRRLL
    NALVRFSLSLDTTLRIARKVFEKHGAPLLVLAKFLPGLGLVSAPLLGTTAVAVWVFLFWDVAGASLWASVWLFGGAALHD
    EIVRLMQWVSASGGTLFDAFAAIFVTFLLYRWAMRMRFRRWLAKIRISPQQLDAMLKSAAPPIVFDARPRAVREKEAYRI
    AGAYPLDLDSPDPLHPDLMTRPIVVYCV
    CPNEATAKRIVSQLQRKRIRHALALKGGLDAWEKHGYPVEPLPADFDAARYA
    APPPVERIAPLEPGGRDGGYPMRAGLTD

    >gi|53717563|ref|YP_105540.1| rhodanese-like domain-containing protein [Burkholderia mallei ATCC 23344]
    MSHVTEIPAADSAAAVAHFAASLAFETDCRDVHDALACGAPDFVLLDVRGPEQYAAAHVPGALNLPHRKIIESKLSEFAR
    DTCFVVY
    CAGPHCNGAARAALRLARLGRPVKLMLGGVTGWLDEGFALARGNGASRRQGGLRQRTAGNDPLRNRNN

    >gi|53716570|ref|YP_105614.1| rhodanese-like domain-containing protein [Burkholderia mallei ATCC 23344]
    MTIELEARATHAVLDAAREAALAAGLPYAGGVSPRDAWALVATGHARLVDVRTAEERTFVGHVPDSLHVPWATGTSLTRN
    PRFVRELEAKTGKDAVVLLL
    CRSGNRSALAAQAAAKAGFTQVFNVLEGFEGDLDDAGHRGTTNGWRLHGLPWRQS

    >gi|53716586|ref|YP_105622.1| YeeE/YedE family protein [Burkholderia mallei ATCC 23344]
    MAVDFVHFTPGLSFAGGLLIGAAAALLVFFDGRIAGISGIVGGLLAGGRSDAGWRAAFLVGLIAAAVAANALDWFSMPAV
    DAGWARVIAGGVLVGIGTRYAGG
    CTSGHGVCGISRGAPRSIVATAVFMAAGIATVFVLRHVVGG

    >gi|77358924|ref|YP_338475.1| pyridine nucleotide-disulphide oxidoreductase, class II, truncation [Burkholderia mallei ATCC 23344]
    MNFDVVIIGGSFAGQAAALQLARARRGVLLIDAKRPRNRFARTSHGFLGQDGHAPSAINATAGRQLAAYPTVQFDAGDAI
    DAAAVSDGFRVSLADGRQAQGRRLILATGVRDILPALPGLQERWGVSVLH
    CPYCHGYELERRPMGVLASSEQAVHQAMLV
    SDWGPTTLFTQGAFVPTREQSAMLSARGVTVEQTPVAALVGAAPALEAVCLADGRTAALCGLFIAPRTVPACDLPERLGC
    VFDDGPTGPYLSVDERQQTSVPGVFAAGGCRAADGECDVGRRRGRDRGSGRASFADLWCGRARLTDGGGDAGHTGAGGAR
    AGPHRRPAMPPCGRLFELPGEPQQDRVNRQFEAG

    >gi|53717250|ref|YP_106074.1| selenophosphate synthetase [Burkholderia mallei ATCC 23344]
    MTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAAL
    GVVHPARVKRNAAARAGDVLVLGKPLGVGVLSTALKKDRLDAQGYAQMIATTTKLNRPGTALAALPGVHALTDVTGFGLL
    GHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASGRNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAP
    EAVDDVLACFRDDGFERAAAIGEMVDGAARVDVS

    >gi|53716307|ref|YP_106343.1| alkyl hydroperoxide reductase, subunit c [Burkholderia mallei ATCC 23344]
    MPIINSPIKPFKATAYHNGDFVQVSDETLKGKWSVVVFYPADFTFVCPTELGDLAERYAEFQKLGVEIYAVSTDTHFTHK
    AWHDTSDTIAKIKYPMIGDPTLAISRNFDVLIEEEGLALRGTFVINPQGEIKLCEIHDNGIGRDAGELLRKVQAAQYAAA
    HPGEVCPAKWTPGADTLTPSLDLIGKI

    >gi|77358981|ref|YP_338521.1| alkyl hydroperoxide reductase, subunit f, truncation [Burkholderia mallei ATCC 23344]
    MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAERAPSFSVGEPGKAAGIRFAG
    MPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYAFETYISLT
    CQNCPEVVQALNVMALVNPRIRHVMIDGALFQ
    DEVEARRIMAVPTIFLNGETFGQGRSSVKEILAKLDGGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHEIRLASGAVLKAKTVVLATGA
    RWREIDLPPTNRASRSLVKFVFGEEDEHEEALYGTANHRVSEGSRGRYAGQGTVQEAWVQ

    >gi|53716212|ref|YP_106398.1| copper-translocating P-type ATPase [Burkholderia mallei ATCC 23344]
    MTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAVADLAAGTATVAAASAIDTARLVAALDAAGYRATVATA
    PAATGNADARHGRARDEDDDAAAAPHTAAVTLTIGGMT
    CGGCARRVEQALAAVRGVADAKVDLATTSAKASVARDVDSQT
    LVAAVEQAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQSFEFDIAGMT
    CASCVGRVEK
    ALAQVPGVVRATVNLATEKAAVDADADAHVDTARLIDAVKRAGYRASPVSDTASALAPSPEIAAARTAIELDIAGMT
    CAS
    CVGRVEKALAQVPGVARATVNLATEKATVDADADAHVDTARLIDAVKRAGYRASPAIAACAPASRATATADAAAARPASP
    SADDRKLAEARRERALVIASAVLTTPLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMDLL
    VALGTSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTLVRFGKWLEARAKRQTTNAIRALNALRPDRARIVEHGVERDVPL
    AQVRVGTVVRVLPGERVPVDGRIEAGVTHVDESLITGESLPVPKEPGERVTAGSINGEGALTVATTAIGAETTLARIIRL
    VESAQAEKAPIQRLVDRVSAVFVPAIVAIAFATFAGWLVAGAGVETAILNAVAVLVIACPCALGLATPAAIMAGTGVAAR
    HGVLIKDAQALELAQRARIVAFDKTGTLTQGRPTVTAFDAIGIPRGDALALAAAVQRASAHPLARAVVAAFDADADARRS
    SLAAAHADTPRAVAGRGVEARVDARLLALGSTRWRDELGIAVPDGVARRAAALEAAGNTVSWLMRADAPREALALVAFGD
    TVKPNARRAIERLAARGIRSALVTGDNRGSATAVAASLGIDEVHAQVLPDDKARVVAQLKATAGDGAVAMVGDGINDAPA
    LAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAVDISRRTYRKIQQNLFWAFVYNLVGIPLAALGWLNPMIAGAAMA
    FSSVSVVTNALLLRRWKGDAR

    >gi|53716068|ref|YP_106528.1| dihydrolipoamide dehydrogenase [Burkholderia mallei ATCC 23344]
    MSDTKTTTLLVIGGGPGGYVAAIRAGQLGVRTILVERDRLGGTCLNIGCIPSKALIHAAGEFDKVRGFAGDSPLGIRTQA
    PAIDIARTVAWKDGIVKKLTGGVGALLKKNGVEVVHGDARVVDGKTVDVDTGGGARVRIQ
    CEHLLLAAGSEPVELPAMPF
    GGNVISSTGALSPGRLPKRLVVVGAGYIGLELGIAYRKLGVEVSVVEARERILPIYDAELTKPVAASLKRLGVRVLLGHK
    VLGLNARGDAVCVQDDAHAQTELAADQVLVTVGRRPRTQGWGLETLQLDRAGAALKVDDMCRTSMRNVWAIGDLTGEPML
    AHRAMAQGEMVAEIVAGKKRHFMPAAIAAICFTDPEVVSAGLAPDEAERTFGACVSASFPFAANGRALTLESADGFVRVV
    ARRDDHLIVGWQAVGAGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVMEAALRALGHALHI

    >gi|53715936|ref|YP_106539.1| pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia mallei ATCC 23344]
    MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGV
    RAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEI
    AATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
    VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVS
    IFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDP
    NYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
    YESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETG
    EPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVE
    VMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
    YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA

    >gi|53715913|ref|YP_106568.1| putative lipoprotein [Burkholderia mallei ATCC 23344]
    MKTAIRKLTASLLVAAAAACFAADAPHAPEHLPPGIAWRQGDVDAAFAEAKRTNKPLFLYWGAVWCPSCNQVKSTIFSQQ
    AFKSRSSFFVPVYLDGDTENAQKIGDRFKVRGYPTMILFRPDGTELTRLPGEVDLDRYMQALSIGLNASHPFKRTLAAAL
    KDGARVTPDEWRVLADYSWDTDGDLPVPGERVAATLQALARHARADHANAQALRLDLKAAVSAAAGDPPQQGDVDKAAAA
    AAVRDALRDPKRARADYDVLVAAPAEVVAYLAGGDAAARALLAKQYDAALARLSTDASLAAIDRTMALHGRVRVARLDAR
    PGAPLPPALADAVRRQTASAVTESTNVYGRQAVVSEAADTLTDAGQFDAADALLKAELVRSPTPYYFMSGLAANAKARGD
    RAAALDWYRKAYEAASGSATRLRWGAAYFANAVDLAPDDAAQIRRIANDVLTQASQTRNAFYGANRRALTRVVTQLARWR
    QRGAHDAAAQAVVKQFEGVCGKLPVGDPQVGTCEGLLKTAKA

    >gi|53716053|ref|YP_106620.1| arsenate reductase [Burkholderia mallei ATCC 23344]
    MITIYHNPRCSKSRETLALVETLNPTGEAINVVEYLKQPLTAAQLKVLHRQLGRPVRDMIRDNEAPYKDLNLADAALSDT
    QLYDAIAEHPILLQRPIVVHGDKAAIGRPPEAVRSLFE

    >gi|53725487|ref|YP_103509.1| hypothetical protein BMA1914 [Burkholderia mallei ATCC 23344]
    MTTVNLAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLFEGKFADLPFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDQGHDDAGRPVVMLDTRNAFEVDVGTFDRALDYRI
    DKFSEFPAVIEANRADLEGKTIVSF
    CTGGIRCEKAAIHMKDVGIENVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLAPTADVTCFACRAVVPADAQQSPLYVPGKCCPACHPGDSGTPGRRAEPGAEPARAV