Burkholderia glumae BGR1 uid59397

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238023354|ref|YP_002907587.1| MerA [Burkholderia glumae BGR1]
    MTRSKLQPHIAVIGSGGAAMAAALKAAEHGARVTVIERGTIGGTCVNTGCVPSKIMIRAAQIAHLRTSSPFDDGVAAVAP
    SIDRGHLLAQQQARVEELRHAKYESILDGNAAITVLPGNARFKDGRTLVVRLHEGGERVVAFDRCLIATGASPTIPPIPG
    LMDTPYWTSTEALNSDAIPARLTIIGSSIVAAEMAQAFARLGSRVTILARSRLVFREDPAIGETLTAVFRREGIEVLQHT
    QASLVEHRDSEFVLTTGHGELRADRLLVATGRSANTHDLNLEAASVTMNTEGAIVVDPAMRTSAPDIYGAGDCTDLPQFV
    YVAAAAGTRAAINMTGGEATLDLSAMPAVVFTDPQVATVGLSEAKAHLSGIETDSRTLTLDNVPRALANFDTRGFIKLVI
    EEGTRRLIGVQAVAPEAGELIQAAALAIHTRMTVEELADRLFPYLTMVEGLKLAAQTFRTDVKQLSCCAG

    >gi|238023367|ref|YP_002907600.1| Alkylhydroperoxidase [Burkholderia glumae BGR1]
    MNQTARLSLSPVSAETAQGRTKEVLDTARQQVGFIPNMYAGMANFPAVLDTYLHGYKLFRTESALTPAEQETVFLAISRA
    NECTY
    CMAAHSMIATAVSKTPVDVVQAIRSDSPIDDPKLAALAEFTRLMVMSRGRPTSEQLSAFVSAGYTEHTVLEIILA
    IAVKTLSNYSNHVFHTEVDQKFQDFAWAPPTQG

    >gi|238023374|ref|YP_002907607.1| Pyridine nucleotide-disulphide oxidoreductase dimerisation protein [Burkholderia glumae BGR1]
    MSAASANHDESTRSGAVRFGVGRLALVAVIGVTIIAFFSLGGLHYVSLDYAKTQQAAFVRLRDLHPLATSLAFLAGYVIV
    AALSIPGAAVLTLAVGALFGVVWGSVLVSFASTIGATLAFAASRYVLRNAVAARFADRLGPIDEGVRREGWMYLLSLRLV
    PAVPFWLVNLMMGVTAIPLRTFYWVSQLGMLPATIVYVSVGTRLPEVTSLRGILSPGLLVGLVALAALPYGTKGLLRALR
    TRRLMARWPRPKQFDYNVVVIGAGSAGLVSSYVASVVKARVALIERHAMGGD
    CLNTGCVPSKALLRSAGVAAELRRAGEF
    GISCMGGVHVDFGAVMRRVARVQANVAPHDSIERYTSLGVACMAGRATITSPHTVEVAADDGSVRVLTTRSIVIAAGSRP
    AIPDIPGLEAVGYLTSDTIWSLETLPAYLVVLGGGPIGCELAQGFARLGAHVIQIEKGPRLLPREDADASAHVLKRFRTE
    GIDVLLDAEVVRCERLGSVKVVVVRTSDGERAIPFDAILCAVGRVANTEGYGLESLGIGVTAAGTIKVDDRLQTLYPNIY
    ACGDVVGPYQFTHMAAHQAWYASVNAMFGRWHRFKVDYRVTPWVTFTSPEIARVGLNESDAVCQGIPYEATTFGLDELDR
    AITDGGTDGFAKVLTAPGKDRILGVTIVGEHAAPLLAEFALAMRHGIGLNGILRTIHVYPTHSEAAKYVAGRWKMDHAPQ
    ALLRLLGRYQAWMRRS

    >gi|238023386|ref|YP_002907619.1| Thioredoxin domain protein [Burkholderia glumae BGR1]
    MLKILLKGLFLLTFIGASASAFAAAQPYDKGRFETALAQGKPVVVWFHASWCPTCRAQQPSVDKLSESPAMKDVTVFVAD
    FDKEVALEKTLRVAQQSTFVVFRGGREVTRSTGETNEQAIRATWEKAL

    >gi|238023388|ref|YP_002907621.1| Radical SAM domain protein [Burkholderia glumae BGR1]
    MHDTFPLLRDTDFPRIHRRSLDCLQVNLGYRCNQSCVHCHVAAGPTRTEQMSRAVIDDVLRVLAKHQIGTLDLTGGAPEL
    NPHFRSLVAEARALDVHVVDRCNLTILEEPGQETLAGFLAHHAVEIVASLPCYSAENVDRQRGDGVFESSIRALVRLNAL
    GYGDESEGHLALSLVYNPQGPVLPLAQQALEADYRRILGERFGIRFTHLLTLANMPIQRFGSTLVSKGTFAAYMKLLKDN
    YVSANLGNVMCRSLISADWQGNLYDCDFNQMLGMPIVHREGRPARVTDLLEDNFVGSTIRVADHCFGCTAGQGSS
    CSGAL
    HPSPAVA

    >gi|238023425|ref|YP_002907658.1| Protein-disulfide isomerase [Burkholderia glumae BGR1]
    MSGSDTVRAAGQRPPRAVPLVPAVNPADPNLEPGLAALQASLHARYPATRFRQITPTPATGIYEVVMGDKIAYTDQTGRY
    FLFGHLFDMVTQQDLTVPLEQALQKVRFPADRLQDAFVEVHGDGHRKVAIFDDPD
    CPYCLSLEAELAALKDVTIYRFLYP
    LESIHPRARAHAIGIWCADDRLGAWHAWLPVALSRWMRDHGSSVIGAAGQRKVPPSPARVEPKLASCDNPIDRNEALAAS
    LGINGTPSLVSVDGRVMPGAATAEAIDQWLGAN

    >gi|238023548|ref|YP_002907780.1| OsmC-like protein [Burkholderia glumae BGR1]
    MSIEKVLYRAQAHATGGRDGRAVVPEGNLDFKLTTPRELGGAGGAGANPEQLFAAGYSACFLGAMKFVAQRDKIAIPENV
    AIDGSVGIGAIPNGFGIEVELRIALPGMDREAAQALVDKAHIV
    CPYSNATRGNIDVTLTIV

    >gi|238023673|ref|YP_002907905.1| Thioredoxin [Burkholderia glumae BGR1]
    MTSSQAYSDDAPTRAEVDALASATVIEFGTNWCGVCKGAQPAIREAFAAHPEIRHLKIEDGPGRPLGRSFRVKLWPTLVF
    LRDGTEVARVVRPTEAAQLEADGFAALA

    >gi|238023735|ref|YP_002907967.1| hypothetical protein bglu_2g02670 [Burkholderia glumae BGR1]
    MNEPITTTLLVIGAGPGGYVAAIRAAQLGVPTVVVERAQPGGTCLNIGCIPSKALIHAADEFDKARHYSGASPLGIRVAS
    PEIDIARTVAWKDGIVAKLTGGVAALLARHGVELVRGDARVLDGKTVEVVRDAARPLRIRCEHLLLAAGSEPVALPSMPF
    GGIVQSSTEALSPATLPRRLVVVGAGYIGLELAIAYRKLGAEVSVVEAQERILPAYDAALTKPVAAALARLGITLQLGRK
    VLGLNPAGDAVRVQDAAGAETALPADRVLVAVGRRPRTQGWGLEALQLDRAGHALKVDDQCRTSMRNVWAIGDLAGEPML
    AHRAMAQGEMVAEIVSGKRRRFMPAAIPAICFTDPEVVSVGLAPHDAAAPADALVASFPLMANGRAMTIEGTDGFVRVVA
    RRDNHLILGWQAVGRGVSELAAAFSQSIEMGARLEDVGGTIHAHPTLGEAVQEAALRALGHALHV

    >gi|238023809|ref|YP_002908041.1| Selenide, water dikinase [Burkholderia glumae BGR1]
    MNSNPQSNPPRLTSLSHGGGCGCKIAPGVLAELLRRNAPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDD
    PYDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLKGGEAVCAEAGIPVAGGHSIDSVEPIYGLAALGI
    VHPSRVKRNAGARAGDLLVLGKPLGVGVLSAALKKGQLDDAGYAAMIAATTRSTARAELAALPGVHAMTDVTGFGLLGHG
    LEVARGARLTARVRYAALPWLAGVEALAASGVVTGASERNWAAYGAEVRLGETLPAAARALLTDPQTSGGLLVACAPDTV
    DAVLACFHADGFAQAAVIGELVDGPARIEVA

    >gi|238024368|ref|YP_002908600.1| YeeE/YedE [Burkholderia glumae BGR1]
    MSLDLAHFTPLPALAGGLLIGLAATLLVLGNGRIAGISGMLGGLLDAGRDRSWRAAFVIGLLGAPWLARLFTTLPAVSIT
    SSPAVLVAAGLLVGIGTRYASG
    CTSGHGVCGLSRGSLRSLAATASFMATGFATVYVIRHLIGL

    >gi|238024468|ref|YP_002908700.1| Thioredoxin [Burkholderia glumae BGR1]
    MSSLKSVTEASFEADVTLNSRPVLIDFWAEWCGPCKALAPTLEKVARNFEGKVDIVKVNVDEHPGLRERFGVRGIPALVL
    MNGADEAGRIVGNRTATQLASYLDAHLGTATQLAKPAVTLSAFGGDAQLKAERIARLRDYLELKQADPNTPMWPEKVTGA
    LAYVAGTSDPDECAVALGMPTDVLDTVASLSTYRSTHLNGARFVADWLESVPVGADLSALPGRLLNEILASPLVSDTLDG
    DAALLAIRDELAALHAAEAGGAQLPEEKWAAVAQAAREVVAAPAEGNRTRAAAVLVAASSSLARNPDMLKDFVSVLCRFV
    QECLKAKCHWGAEDESRLFKLMDGIFKHALDTGAEPPRGPAMMKHVAEIDPRLAERFLFQYEEGDRASRERGGAIGDMLI
    SLTRRCA

    >gi|238024550|ref|YP_002908782.1| Alkylhydroperoxidase like protein, AhpD family protein [Burkholderia glumae BGR1]
    MNGLRLEYWNLSPRLLQGLRDVKDGLEHSTLGLPLIELVYLRIAQINGCSFCLNKHTKSLRERNETDRRLAELAGWRVSS
    QFTAREKAALEWTESLTHVAVTHADDASYRPLEGHFSAVEISDLTFAIALMNAMTRLAVGMRRD

    >gi|238024632|ref|YP_002908864.1| hypothetical protein bglu_2g12470 [Burkholderia glumae BGR1]
    MWHFPVAIPSSLGPWAVFLSVLVTQLGLPVPAAPMLILGGTMAAMGQASYTSMFVAAISATLLADSLWFSAGRLRGRRLL
    NGLVRYSLSLDTTLRIARNVFERYGAPILIVAKFVPGLGLMSAPLLGTTSIAVPVFLLWDVAGASLWASAWLLGGAALDH
    EIVRIVLWVRSSGGTIFDAFAAIFVTFLLYRWLRRIQFRRWLAKVRIEPAQLDAMMKSAEPPLIFDARPRAIRQQDAYRI
    AGAYPLDLDSSEQLDPALLNRPLVVYCV
    CPNEATAKRIIQQLQRKNIHHVRALKGGLDAWEKHGYPVEPLPADFDASRYT
    VKPEREMDGEYTVRARLSDT

    >gi|238024730|ref|YP_002908962.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia glumae BGR1]
    MPIINSQIKPFKATAYHNGDFVPVSDESLKGKWSVVVFYPADFTFVCPTELGDLADRYEEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIAKIKYPLVGDPTATLARAFDVLIEEEGLALRGTFVINPEGEIKIAEIHDNGIGRDAGELLRKVQAAQYVAS
    HPGEVCPAKWTPGAETLTPSLDLVGKI

    >gi|238024731|ref|YP_002908963.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia glumae BGR1]
    MLDANLKNQLKSYLDKITRPIELVASLDNGAKSKELIELLNEIGSLSPRVSVVERRDDAERKPSFSIGEPGKPTGIRFAG
    IPMGHEFTSLVLALLQVGGHPLKLDDATIEQIRNLEGDFSFETYFSLS
    CQNCPEVVQALNVMALLNPRIRHVAIDGALFQ
    NEVDERQIMAVPTMFVNGQHFGQGRSSVKEILAKLDTGASARAAKELDKKDVFDVLIVGGGPAGAAAAIYAARKGIRTGV
    VAERFGGQVLDTMAIENFISVQETEGPKFAVALEQHVKQYDVDIMDVQRATALVPGAINEIRLENGATLKAKSVILSTGA
    RWRELNVPGEREYRNKGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVREVTLIEFGEALRADEVLQRKLRSLK
    NVTIITSAQTKELLGDGQKLNGLVYLERTTGETKRIELEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSLPGVF
    AAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRQDVEAPAAAQAGEAVAA

    >gi|238024804|ref|YP_002909036.1| Disulfide isomerase/thiol-disulfide oxidase [Burkholderia glumae BGR1]
    MRAGIVARTGRAAAPRAPAPPACARMHPRRRARPMSDLRGFPLHHDEDFMKTRIRIALAAAALTVGLTSRAAEPPPALTD
    AQMLRVQAAPAIVEGASGARVKSTLYVFMDPN
    CIYCHLMWKALRPYEAAGLQVHWIPLAFLKPDSAGKAAALLKAPDGGA
    ALLDTLETKYSEKDESGGIAPLTVVPADAKAKLDANAAMFKALGFDGTPTVLFRSHDGKWLGLDGLPRLSMLPGMLNMVE
    QPITDPELQRYR

    >gi|238024852|ref|YP_002909084.1| Electron transport protein SCO1/SenC [Burkholderia glumae BGR1]
    MSTRSAPPAFRASRRAATLAIVGALAGVSLLSGCKPSEPSFTNLDITGNTQFGRDFSLPDTDGRIRTLADYRGKVVVLLF
    GYTH
    CPDVCPTTLAELAQALNQLGPDVAKRVQVLFVSVDPKRDTNPVLAQYVSAFDPSFRALRPANEAQLKQVSRDFRIT
    YEQVAGSNADNYSMNHTAASIVFDPSGKPRLFARDGQGTAPWVHDLPLLLKQDA

    >gi|238024889|ref|YP_002909121.1| DSBA oxidoreductase [Burkholderia glumae BGR1]
    MSQPLTIDFVSDVACPWCAVGLSSLLIALERVGDAADVQIRMHPFELNPNMGPEGESIVEHIGKKYGRTPEQVAEAQAML
    RERGASVGFTFGQREAIHNTFDAHRLLHWAGLEGRQLPLKLELLRACHGEGKRTDDPELLAAAAQAAGLDAERAREVLAS
    GAYAGEVRAAEREAQALGISSVPSVIFNERYLVTGGQPAEAFERAIRQILAEAAEPTAGPTA

    >gi|238024894|ref|YP_002909126.1| Methionine sulfoxide reductase B [Burkholderia glumae BGR1]
    MTSRRAFLLTGAALAGAVATITRSGVFAQQPPKPAAPAELTLSDAEWRKRLTPAQYTVLREAGTERPYSNPLNDEHRSGT
    FACAGCALPLFSSATKFDSHTGWPSFWAPLDHAVVTSTDTSFGMVRDEVHCRRCAGHLGHVFNDGPKPTGLRY
    CMNGTAM
    TFSPSSA

    >gi|238024895|ref|YP_002909127.1| Cytochrome c biogenesis protein, transmembrane region [Burkholderia glumae BGR1]
    MLLVILAYLGGVLTIVSPCILPVLPFVFARADRPFVRNGLPLLAGMAVTFAAVATLAAVGGGWIAQANQAGRWLAIAMVG
    VFGLTLLLPSLAEHMTRPLVALGNRLTGVASTADGEGRSSIGASLLIGVATGLLWAPCAGPILGLVLTGAALRGASVGTT
    LLLVAYAAGAATSLAAALLVGGRLFAAMKRSLGAGEWIRRGLGAAMLAGVGAIALGLDTGVLAQVSTIATGGLEQSLVNR
    FAPRGNAMHGAAGGAVANANGPAMTASSAAAGDGPAMMAAGDAMRAAANGAGNHAAAGSGPAMMAAGDAMRAAANGAGAD
    AAAGTAPAANALMSAATRAARRDASMLRVSAPALPVEGTLPPLSGATKWLNSPPLTNASLRGKVVLIDFWTYS
    CINCLRT
    LPYVKAWARKYKNDGLVVIGVHAPEFAFERDPGNVKQATRDLGVTYPVAIDNGYAIWRAFNNEYWPAHYFVDAQGRIRYH
    HFGEGDYLQSERAIQQLLVEAGHPDAAQVPVGIDGPAASGAQAAADDTDMRSPETYVGYARAEHFASPGGQLHDSEHDYA
    APAQPGLGQWGLAGSWKVGGEQATLVKPGGRIVYRFHARDLHLVLGPGGGGAPVRFRVTLDGSAPGASHGADVGADGTGT
    VAGQRLYQLIRQRGPIADHTFSIEFLDPGVQAFAFTFG

    >gi|238024896|ref|YP_002909128.1| Peptide methionine sulfoxide reductase [Burkholderia glumae BGR1]
    MKPIRHDLAPCPRRRASRAGLLMRLAGGAAALGALAAVLLGWQPAALADAARPLPAPVLDETPGATRTETAVFSGGCFWG
    VQGVFEHVAGVEQVAAGYAGGAASTAQYEAVSEGDTGHAESVRVVYDPSRITYGRLLQIFFSVAHDPTELNRQGPDTGTQ
    YRSAIFPVDAQQKAIALAYIRQLTDAHAFPAPIVTSIEAGQRFYPAEAYHQDFLVRHPAYPYIVINDLPKVAALKAGYPK
    LYVDTPVRYAPDGN

    >gi|238024898|ref|YP_002909130.1| Methylated-DNA--protein-cysteine methyltransferase [Burkholderia glumae BGR1]
    MSQVCMRMPSPVGELTLVARGDKLVAILWDNDLPTRVKVGAMRDDPTHPTLVETARQLREYFAGERTVFEIALEFHGTEF
    QKRVWHALLTIPFGETRSYRDIAVQIGNHRATRAVGAANGRNPLSIVAP
    CHRVIGSSGDLTGFAGGKDRKAALLALEARS
    RQPALF

    >gi|238024921|ref|YP_002909153.1| Thioredoxin [Burkholderia glumae BGR1]
    MSSLKSVTEASFEADVTLNSRPVLIDFWAEWCGPCKALAPTLEKVARNFEGKVDIVKVNVDEHPGLRERFGVRGIPALVL
    MNGANEAGRIVGNRTATQLASYLDAHLGTVTQLARPEVTLSAFGGDAQAKADRIARLRDYLERKQADPNTPMWPEKVTGA
    LAYVAGSSDPDDCAVALGIPSAVVEVVNSLFTYRGTNFNAALFVADWLESVPVGADLSKLPGQLLTSILAGPIVSETLNG
    EPRLLAIRDALVSLHAAETNGSPVGDASWAEHKQACQAVAAGLGEGNAARAAAVLEVAASSAAKNPDMLRGFVAAVCGFV
    RKCRQAECNWSPEDDSRFSSIAKGIYKHAIETGAEPPMGDAMRKRIAEVDPELVARFKFHYDEGWRSAQERGTAFGDLLI
    ALTRQTEVASPV

    >gi|238024943|ref|YP_002909175.1| Rhodanese domain protein [Burkholderia glumae BGR1]
    MSHTHYTTLISADNLAERLAAAPDSLIVFDCRFDLTDPDAGAQAYAAGHLPGARYLHLDRDLSGPKTGSNGRHPLPARET
    LVATLAAKGLRANQQVVAYDAQGGIYAARLWWLLRWLGHDSVAVLDGGLQAWQAAGGTLTRDMPAERAGDFRAQPPLATV
    VDAAAVVANLASKARLVVDARAADRYRGENETLDRIGGHIPGAVNRFFKDNLNPEGRFKSGHQLRDEWISVIGEQPANNV
    ILQ
    CGSGVTACHNALAMEIAGLHNPLLYAGSWSEWSADPSRPIATGPTR

    >gi|238024964|ref|YP_002909196.1| OsmC family protein [Burkholderia glumae BGR1]
    MNILYQTSATSTGGRDGRAVSADNQLDVKLAAPRELGGSGAEGTNPEQLFAAGYSACFLSAMKFVAGQTKQALPADTAVT
    GQVGIGPNDQGGFGLDVELRISLPGLEPEAAKALVDKAHEV
    CPYSNATRNNVPVRIVIA

    >gi|238025025|ref|YP_002909257.1| OsmC family protein [Burkholderia glumae BGR1]
    MPLIHAAAAMAADAPNYLVDIQAGAHRFQGDEAEREGGRGIGPAPFELLLASLCACTAATLRMYLQRKDWPAVPLHVHAE
    LHADHDGVQYVRRTITIEGDALDAAQRARLGEIGEKTPVTLFLKRGTRIETTLR

    >gi|238025120|ref|YP_002909352.1| Rhodanese-like protein [Burkholderia glumae BGR1]
    MFSTGAALPEARDRRACRGTPPGLAFPFLSLPMNAVSDSATFSARSAAAVSDAAFPRLSVAEVRAALLAREEIALVDVRE
    EAPYAAGHPLWAANLPLSTLELEAWTRIPRRDTAIALYGEYGDEDLAPRAASVLAGLGYTRVHLLDGGLAAWSRAGGELF
    IDVNVPSKAFGEYVEAKRHTPSLSAQEVQALIESRADVVIVDARRFDEYQTMSIPTATSVPGAELVLRVRELAPDPATRV
    IVN
    CAGRTRSIIGTQSLVNAGLPNPVAALRNGTIGWTLAGQALEHGATRRFPEAVADAHRAAARDGARAVAARAGVKRVA
    PAEVDALGEGGRRTVYRFDVRTPGEYAAGHLPGFTSAPGGQLVQETDHHAPVRGARIVLADDDGVRADMSASWLAQMGWD
    VYVVEPAQAASGGEAGMPPARAPEAAPVARVTPATLAAWLDAADGDVPAVIDVSAGANYVKRHIPGAWYVIRARLREALA
    AIPAARRYVLTCGTSQLAAFAAADLRALLPAEVGVFVLDGGTQAWIDAGLPLEQGETRLASQRDDRYRRPYEGTQNAAAA
    MQAYLDWEFGLVAQLGRDGTHHFHVI

    >gi|238025142|ref|YP_002909374.1| Rhodanese-related sulfurtransferase [Burkholderia glumae BGR1]
    MSFVTEIPAAESAAAARHFAATLRFETDCWDVHHALACRAADFVLLDVRSPELFAAGHIKGAINLPHRKIVASRLSHFPI
    GTMFVVY
    CAGPHCNGATRAALRLARADRPVKLMPGGITGWLEEGFELVTEQ

    >gi|238025162|ref|YP_002909394.1| Organic hydroperoxide resistance protein [Burkholderia glumae BGR1]
    MSVDAKYKTTATASGGGRDGKTELADGTLSFQLSVPKELGGPGGDGANPEKLFALGYSACFLGAMRVASQQTKIKVPEGT
    TVTATIGIGPRSEGGFGITAALDVYLPGVPEADAAKLVETTHDI
    CPYSNAIKASVDVATNTRG

    >gi|238025232|ref|YP_002909464.1| hypothetical protein bglu_2g19040 [Burkholderia glumae BGR1]
    MSERIHYQQAAPAGYKALVGVHAYVSQCGLDATLVDLVYLRVSLINGCAYCIDLHTRDLRKHGVAVEKIVLVPVWHEAKS
    LFSAREQAALAWAESVTRVAQTGVPDSDYQAAASVFGEKELADLTIAIGLMNSFNRLAISFRNVPAAALAAQG

    >gi|238025306|ref|YP_002909538.1| Glutathione S-transferase, N-terminal domain protein [Burkholderia glumae BGR1]
    MKTHTLFYCPGHLSFAPHVILRELGEPFELALVSIKDGATQSAEFRRLNPKGKVPVLHTGDEVLTESSAILLYLALRFPQ
    ARLLPDTAMGVARAVEWMNWLASVLPGTVALNFHPSRFSDDTAAHDGIREKGRTLILAAYAQIDERLCARDWALGEHYSI
    VDPMLLIFFKWGNMLQLDMRGFAHWAAHTERMLSRPAVATALAVEQLSVWA

    >gi|238025462|ref|YP_002909694.1| Alkylhydroperoxidase like protein, AhpD family protein [Burkholderia glumae BGR1]
    MSRLSTLAPADATGAAAEVFAKIRKAVGKVPNAYATIGTHHPEALAAMLGVDALVAGGTLGKAEIETIKLAVSEAAGCDY
    CVAAHTLAGKFAGLSPETMQQVRAGEPTGDARRDALVAFVRTLVTTRGTVPADAFERFIAAGFTERQVVEVSLAITSITF
    TNLINRANDTTLDFPAVK

    >gi|238025469|ref|YP_002909701.1| Cation-transporting ATPase membrane protein [Burkholderia glumae BGR1]
    MTDLSNPAPHQTTELRIEGMTCGGCARRVERTLAQIPGVATAQVDLEAKTASVTCLPDVDAKTLAEAVTAAGYPARVLPR
    HDASGTPPAPQPTTSPESPVGSDAGPATHVLAVRVGGMT
    CGGCARRVEQALAGVNGVVHARVDLGAATATVEADHEVGAQ
    TLIDAVAAAGYRAEPAHAVPSAAAARASEAAAPVAVAFAPQPTPRAKPAVDAAPAASDAPASPTTAIELDIGGMT
    CASCS
    NRVEKALAQVPGVSSATVNLATERASVSAAASVSAAQLVAAVEKAGYRAAPTAHSAPAACAPHARPSAESRKAAEAHRDL
    MLLIGSALLTVPLVAPMLAAPFGVSATLPAWLELALAAVVQFGFGARFYRAAWHALRARAGNMDLLVALGTSAAFGLSLW
    QLLRAPGHAEHLYFEAAAVIVTLVRFGKWLEARAKRQTTDAIRALNALRPERARIVEQGAEREVPLAQVQVGAIVAVRPG
    ERFPVDGTILAGESHVDESLITGESLPVAKAPGDRVTAGAINAEGALTVETTAIGAETTLARIIRLVESAQAEKAPIQRL
    VDRVSAVFVPVILAIALVTLAGWLLAGADTETAILDAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIQDALALELA
    QRAAVVAFDKTGTLTEGKPAVTAFDALGLARGEALAIAAAVQRQSDHPLARAMVAAFEREAPAGAAALPVAEARAVAGRG
    VETRVGAAGHATRYAIGSARWLAELAIEMPAGAKARAAELEAAGNTVSWLMRLDAPQAVLALIAFGDTVKPGARDAIGQL
    HALGIRTALVTGDNRGSAAAVARTLGIDEVHAQVLPDDKARVIGDLKATSRGVVAMVGDGINDAPALAAADIGMAMATGT
    DVAMQSAGITLMRGDPALVAAAIDISRRTYRKIRQNLFWAFVYNLVGVPLAAFGLLNPMIAGAAMAFSSVSVVTNALLLK
    TWKAGTR

    >gi|238025510|ref|YP_002909742.1| Rhodanese domain protein [Burkholderia glumae BGR1]
    MLHDLIARYGPLIVFVNVLAAALGLPVPAMPTLVLFGAMATLHPEVFGMQLVPVLLLSVAAALLGDSAWYAAGRRFGGKT
    LRTICRLSLSRDSCVKKTEQFFGRWGVRVLAIARFVPGLSLVSVPLAGALGTRYRTFVGYDALGALLWAAAGLLIGLVFA
    EQIDWLLAAASRLGHAALAVVAVLLALYASVRWMRRRALLRQLVHARIGVDELDRLLHADAGPPPVVIDVRTAEHRRLDP
    FSIPGAVFADERHIRDLAARYPLSQRFVTYCA
    CPNEVSAVLMARRLSDAGFTDALALRGGLDAWRDSGRPLAGIVLAEPV
    PAAPAPKTA

    >gi|238025961|ref|YP_002910192.1| Putative thiol:disulfide interchange protein DsbD [Burkholderia glumae BGR1]
    MSDRHFSAAACLRLLLACLVLFGALFGLSPAARADGDFLDPSLAFRFSSSESPGQVNLHFSIADGYYMYRERFAFAVKSG
    TATLGEAQIPPGHVKYDETFAKNVETYRGELTIHVPVVKAAGPFELSVTSQGCADGGICYPPAEHVVRVDGTALAAAPAA
    GSPAQSSVPAAAPQAPAPAAQGAVAPASLAPPAADGSWYERVTSADYARSLLEGRGFLTVVALFFVAGMVLSLLPCSYPM
    IPILSAIIIGEGTRATRARGFALSLTYVVGMALVYTVLGIVAALIGQSLGAWLQNPWMLGAFALLLTVFALTLIGGIDIA
    LPQRWQDGAAQASSRRSGGRFAAVAAMGALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGIGLGVPLLIIGLG
    AGTLLPRAGAWMEGVKVFFGVVLLAAALWIVWPVLGAAVQIALAALWLLIAAAATGLFTPAAGGASIWRRLGRGVGAAFA
    IWAAVLLVGLAAGSTDPLRPLSVFAARGAGAAAGAAAGTGAHEGPSFAPVRSSAELDRIIQTAGRPVLLDFYADW
    CVSCK
    EMEHLTFTDPRVQARLGQLQLVRADVTANNGDDQALLKRFGLFGPPGIIVFGLDGRELGRVVGYQDAERFLRSLDRAGAP
    SA

    >gi|238026024|ref|YP_002910255.1| Glutathione S-transferase [Burkholderia glumae BGR1]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|238026090|ref|YP_002910321.1| Glutaredoxin-related protein [Burkholderia glumae BGR1]
    MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAIQVLKACGVDQIKTVNVLEDEEIRQGIKSFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFAAA

    >gi|238026102|ref|YP_002910333.1| Thiol:disulfide interchange protein DsbC, putative [Burkholderia glumae BGR1]
    MKTIVRIAALVLATAAATLGCTAQADQTTDKLKATLQARLGDATVKGITKSPIPGLYEVNLGSQIVYSDAAGDYVLLGEL
    VDTKSRKNLTEARMAEINKVDFASLPLGNAIKVVKGNGARKIAVFSDPN
    CPYCKRFESTLQSMDNVTVYTFLYPVLTPDS
    TVKSKAIWCASDRAKSWEGWMINHQPPAGAGNCDTTALEKNLALGRSLNVRGTPTIFLADGTRLPGAVSADELNNALASV
    K

    >gi|238026138|ref|YP_002910369.1| AhpC/TSA family protein [Burkholderia glumae BGR1]
    MIQAGDTLPDAQVFEFVDEAREGCTLGPNALGVREQTAGKRVVIFGLPGAFTPTCSARHVPGYVELAEPLRAAGVDEVWC
    VSVNDAFVMGAWGRDLHTAGKVRMIADGSAALTQALGLTQDLSARGMGIRSQRYAMVVDDGVVKTLAVEAPGKFEVSDAA
    SILAALTR

    >gi|238026172|ref|YP_002910403.1| Redoxin domain protein [Burkholderia glumae BGR1]
    MSKVTLGGNPIDLAGEFPAVGSQAPDFKLVGQDLGELTLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAAGKLADTVVV
    VVSADLPFAAKRFCTTEGLENVSTASTFRGGRDFAQAYGVDVTSGPLNGLTARAVVVIDANDKVIYTELVDEIKNEPNYD
    AALAALK

    >gi|238026174|ref|YP_002910405.1| Ribosomal protein L11 methyltransferase [Burkholderia glumae BGR1]
    MSYRELVAELAREHAEALSDALIELGALSVSVEDADADTPDEQPLFGEPGLTPERTAWQHSRVIALLADTHDPAVLLAAA
    ANEAGLGAVPSFTLREVEEQDWVRVTQSQFDPIPIGQRIWVVPSWHDAPEPDALVLELDPGLAFGTGSHPTTRLCMEWLE
    QTVEAGQSVLDYGCGSGILAILAKKCGAGRVIGIDIDPQAVESARHNSERNRAEVDYGLPDDCPPGEFDIVVANILSNPL
    KLMASMLASKVRPGGRIALSGVLARQADEVAGVYARYIDMSVWREHEGWV
    CLAGTRRESH

    >gi|238026178|ref|YP_002910409.1| Redoxin [Burkholderia glumae BGR1]
    MNSKRLVSAAVAAVAIAGGLAAGHWVRGDAFENTAEAAPVGDPVSALWAAPVTDPDGKPQSLASFKGQKVVVNFWASWCG
    P
    CVKEMPELVALSHEYRQKGIRFVGVGVDSGQNVKAFLQKVKVDYPVVVSGYAGADLARNFGNTAGALPFTVVIDANGKV
    RMTKLGEIQPDALKKTLDTL

    >gi|238026238|ref|YP_002910469.1| Iron-sulfur cluster assembly accessory protein [Burkholderia glumae BGR1]
    MNAVTESAATTPTEMPAPFVFTDAAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKSGVQLL
    IDSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|238026354|ref|YP_002910585.1| Putative oxidoreductase [Burkholderia glumae BGR1]
    MSLRLGDTAPDFEQDSSLGRIKFHEWLGDSWGVLFSHPADYTPVCTTELGLTAKLKDEFEKRNVKAIALSVDNVESHKGW
    INDINETQATSVNFPILADSDRKVSELYDMIHPNANETLTVRSLFVIDPKKKVRLTITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLKDEDELKQRFPKGYKALRPYLRLTPQPNKQ

    >gi|238026430|ref|YP_002910661.1| Rhodanese domain protein [Burkholderia glumae BGR1]
    MPMQILTAPALAAWLADPSRPAPVVLDVREPWEVATASLAGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFL
    ESRGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|238026468|ref|YP_002910699.1| Thioredoxin-disulfide reductase [Burkholderia glumae BGR1]
    MSTKHAKVLILGSGPAGYTAAVYAARANLSPLLITGIAQGGQLMTTTDVENWPADPNGVQGPELMQRFLEHAERFNTEIV
    FDHIHTARLDEKPIRLIGDSGEYTCDALIISTGASAQYLGLASEEAFMGKGVSA
    CATCDGFFYRNQDVAVIGGGNTAVEE
    ALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKEKEGKVEIKWNHVLDEVTGDDSGVTGVRIKHTGTGETEQIALQGVFV
    AIGHKPNTDIFQGQLEMKDGYIVTKSGLAGNATATSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLHDAN

    >gi|238026506|ref|YP_002910737.1| Disulfide bond formation protein DsbB [Burkholderia glumae BGR1]
    MNDFSLSPRHERRLLTLLGVVCVGLLAGAMYLQLAKGEDPCPLCIIQRYFFALIAIFAFLGTGLRSRRSLAVIELLIVIS
    ALGGAAAAARHLQVQLHPGFS
    CGFDALQPIVDSLPPAQWLPSVFKVGGLCETVYPPILGILLPGWALIGFVLIAVLVGAS
    LLRKRRPI

    >gi|238026614|ref|YP_002910845.1| Putative glutaredoxin [Burkholderia glumae BGR1]
    MALTLYGRGWCHLCGEMRAALAPLAAEFGVEVDYLDVDADPALVARYDEDVPVLLLDGVELCRHRLDPRCVRAALERRAA
    R

    >gi|238026666|ref|YP_002910897.1| BcpB, putative [Burkholderia glumae BGR1]
    MKRKIVSTLAVAALAMHALAAQAVLKAGDAAPEFTTQASLGGKTYSYSLASELKKGPVVLYFYPAAFTTGCTIEAHAFAD
    AVDEYKRYGASVIGVSADNIGTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPAVDRANRVSYVISPEGKVIYEYTSMA
    PDKHVENTLNAVKAWAAAHKAQ

    >gi|238026887|ref|YP_002911118.1| Glutathione peroxidase [Burkholderia glumae BGR1]
    MSTLYSFSANALGGGEVSLDAYRGKVLLIVNTASECGFTPQYAGLQQLHERFGARGLAVLGFPCNQFGGQEPGDAAQIGA
    FCEQRFGVTFPLFEKIDVKGEHAHPLFRYLTDEAPGLLGTKMIKWNFTKFLADRSGNVVKRYAPQTKPDEIAEDIEKLL

    >gi|238026891|ref|YP_002911122.1| hypothetical protein bglu_1g12590 [Burkholderia glumae BGR1]
    MTTVVYGIPNCDTVKKARSWLDDHDVAFDFHDFKKAGLTEAVIKGWLKDVPLEVLVNRRGTTWRALPDEAKAAADSEAGA
    IALMLDKPSVIKRPVVVVDGRVKAVGFVADQYAALFAA

    >gi|238026990|ref|YP_002911221.1| Methionine-R-sulfoxide reductase [Burkholderia glumae BGR1]
    MPHDQDDRRYPYQADDAELRERLTPMQYEVTQHAATERAFTGEYTDTEEPGIYRCVVCDTPLFESGAKYHSGCGWPSYFK
    PLAAEVIDEKIDRTHGMVRVEVRCNHCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFEPDAGR

    >gi|238026991|ref|YP_002911222.1| hypothetical protein bglu_1g13690 [Burkholderia glumae BGR1]
    MAASLPAASAAAALADLAASLAAPRDDAFVGLGPAFLTRLPAAPLPAPYVIGFSDELARELGLDPSIRALPGFAELFCGN
    PTRDWPAAALPYATVYSGHQFGVWAGQLGDGRALTIGELEHAGRRVEFQLKGAGRTPYSRMGDGRAVLRSSIREFLCSEA
    MHHLGIPTTRALALIGSDQPVTREEIETAAVVTRVADSFVRFGHFEHFFANDRPDLLKQLADHVIARFYPDCRAADDPYL
    ALLEAVMQRTARMLAQWQAVGFCHGVMNTDNMSILGLTLDYGPFGFIDGFDASHICNHTDTQGRYAYRMQPRIAHWNCFC
    LAQALLPLIGQQRTELDDDPRTERAVEDAQAVLARFPETFGPALEAAMRAKLGLALELEGDAALANRLLEIMNGSRADFT
    LTFRRLAHLSKHDARADGAVRDLFIDRAAFDGWAAQYRERLAAEPRDDAARAEAMNRVNPKYVLRNHLAETAIRRAAEKD
    FSELERLARILRRPFDEQPEYEAYAALPPDWASTLEVS
    CSS

    >gi|238027027|ref|YP_002911258.1| Putative bacterioferritin comigratory protein (detoxification) [Burkholderia glumae BGR1]
    MSVEIDRPVPDFTAPATGGEFTLSSLNGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEIVGVSRDSLRSHDSFK
    AKLELPFPLVSDPDETLCAMFGVMKLKKMYGKEVRGVERSTFLIDGDGVLRREWRGVKVPGHVDEVLDAVQAL

    >gi|238027055|ref|YP_002911286.1| Thioredoxin [Burkholderia glumae BGR1]
    MSEQIKHISDTSFEQDVVRSDKPVLLDFWAEWCGPCKMIAPILDEISKEYGDKLTIAKINVDDNTATPARYGVRGIPTLI
    LFKNGVLAAQKVGALSKSQLTAFLDSHL

    >gi|238027422|ref|YP_002911653.1| YeeE/YedE [Burkholderia glumae BGR1]
    MSTLPSSPARAPRALGAINPKSLGFALLLVVLGAVYLARAVSLRQAALYLVGALLGMTLYHAAFGFTSAWRVFIADRRGA
    GLRAQMLMLAIGVLLFFPALSGGTLFGHPVTGLVSPAGTSVVVGAFLFGLGMQLGGGCASGTLYTVGGGSTRMIVTLLAF
    VAGSVVATAHMPFWTSMPQWKPVSLVHAFGVLPALALSLAVFAAIAALTVVIETRRHGGLVREARAPHTSPWLHGPWPLL
    AGAVALALLNFATLALSGRPWGVTSAFALWGAKGFAALGIDVASWKYWTAGPNAAALAAPASHDVTTVMDIGIVLGAMAA
    ASLAGRYAPVWRVPLRSLLAAVAGGLLLGYGARLAYG
    CNIGAYFSGIVSGSLHGWLWLVCAFAGNVLGTRLRPWFGLEVE
    RVKPSGC

    >gi|238027574|ref|YP_002911805.1| Dihydrolipoamide dehydrogenase [Burkholderia glumae BGR1]
    MSKEFDVVVIGAGPGGYVAAIRAAQLGKTVAVVEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENASHHLADHGIS
    VGDVKMDTAKMLSRKDGIVEKMTGGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGETEVVTARNVIIATGSKARH
    LPNVPVDNRIVADNEGALNFDTVPNKLAVIGAGVIGLELGSVWRRLGADVTVLEAMPAFLAAADEAVAKEAAKLFKKQGL
    DINLGVTIGEVKASDAGVSIAYTDKDGNAKTLEADRLIVSVGRVPNTDNLGLESIGLKANERGFIDVDDHCRTALPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTSPEIAWVGKTEQALKAEGREIKTGKFPFSINGRALGM
    NAPDGFVKMIADAKTDEVLGVHIISANASDLIAEAVVAMEFKAASEDIARICHPHPSLSEVVREAALATDKRSINS

    >gi|238028018|ref|YP_002912249.1| Iron-sulfur cluster assembly protein IscA [Burkholderia glumae BGR1]
    MAITLTEKAAQHVQKYLTRRGKGLGLRLGVRTTGCSGLAYKLEYVDDVAAEDQVFESHGVKVVVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|238028029|ref|YP_002912260.1| Dihydrolipoamide dehydrogenase [Burkholderia glumae BGR1]
    MSLIEVKVPDIGDYNDIPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSAAGVVKEVKVKVGDPVSQGTVIVVLEGAA
    EAAQPAAKAPEASAAKAAEKPAEKPAEKAAPQAGSYSGKADVECDMLVLGSGPGGYSAAFRSADLGMKTVLVERYATLGG
    V
    CLNVGCIPSKALLHTALVIDEAAALADHGITFGKPEVNLDKLRDFKSSVVKKLTVGLAGMAKARKVQVVSGVGSFVDPY
    HLEVEGEGGKTVVKFKQAIIAAGSQAVKLPFMPEDPRVIDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPADAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQLKAEGVKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|238028466|ref|YP_002912697.1| Thioredoxin [Burkholderia glumae BGR1]
    METTLATFERDVIEASLDVPVLVDFWAPWCGPCKTLGPLLERIEADYAGRWKLVKVNVDENPELSAHFQTRSIPHVIAFA
    DGRAVDQFVGVLPEGQIRAFIDRLLPSPDDAERRAAQIALAEERYDDAIKHLQAALALNPGQDDIRLDLIELLLAVDRVD
    AARDEATRLSPQTVNGVDPRYQAIKTRFDSLDAAVELPPTDALEARIAADGNDLEARFDLAQLLIAHRVYEGALEQLLEI
    VKRDRTFKDDVGRKTMVSVFELAADQPNLVAAWRRKLSALLY

    >gi|238028471|ref|YP_002912702.1| Peptide methionine sulfoxide reductase [Burkholderia glumae BGR1]
    MENQVSTAVLGGGCFWCTEAVFLDVVGVHSVESGYAGGSVPNPTYAAVCEGDTGHAEVVKITFDPARVGYRDILEIFFAT
    HDPTQLNRQGADVGTQYRSVVFAENEEQRAIAQEVIDALERDKVFDAPIVTRVEKLDGNFWPAEEYHRDYFARNPQQGYC
    AAVIGPKIAKFRQKFAHRLKSNRG

    >gi|238028713|ref|YP_002912944.1| Glutaredoxin-like protein [Burkholderia glumae BGR1]
    MNKVLMYSTQVCPYCMMAERLLKQRGVEQIEKVLIDKDPSKRAEMMERTGRRTVPQVYIGETHVGGYDDLSKLDREGGLL
    PLLDAA

    >gi|238028714|ref|YP_002912945.1| hypothetical protein bglu_1g31780 [Burkholderia glumae BGR1]
    MTFFTDYTNLALIAILLVSGGMLIFPTLRRGGGGLSAGEATQLINRRNAIVIDLRPAAEYGTGHLPAARSLEFSELAGKL
    GQVAKNKSAPVLLV
    CQNGQQSNKAAKLVREAGYGEVHVLQGGLAAWQKAGMPVVK

    >gi|238028717|ref|YP_002912948.1| hypothetical protein bglu_1g31810 [Burkholderia glumae BGR1]
    MNDEQLLRYSRHILVDEIGIEAQQRFLDAHALIVGAGGLGSPAAMYLAAAGVGAITLVDADTVDLTNLQRQILHATESVG
    RRKVESGREALARLNPEIVVHAVAERVGAAWLDAAVPLATVVLDCSDNFATRHAINRACAAHRIPLVSGAALRFDGQIST
    FDFRDAASPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGQTLVGRLMMLDSLRMEWNTMRIARQ
    PDCPVCGGTH

    >gi|238028728|ref|YP_002912959.1| hypothetical protein bglu_1g31920 [Burkholderia glumae BGR1]
    MSPAPSSFRTSPLRYVAIAVLAAAIAVAGYFALNGKSSVPDATFTLLSGQKVSTASDLKGKVYLVNFWATSCETCMKEMP
    QMVDTYNRFKGQGLEFVAVAMSYDPPMYVANYAQTRRLPFKVALDDGSVARQFGNVQLTPTTFLVDRDGKILKRYVGEPQ
    FAELDQLLQKALATNA

    >gi|238028769|ref|YP_002913000.1| Thiol:disulfide interchange protein DsbA [Burkholderia glumae BGR1]
    MKKLLSMLFLSIGLVAGAAHASPSAPVAGKEYEVMKAPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTLEAWVKKQGDNIV
    FKRVPVAFREDFLPHSSMYYALHALGLAEKDTPAVFNAIHKEKNYLLTPQAQADFLATLGVDKQKYLAVYNSFSVQGEVK
    QASEMLKSYNIDGVPTMVIQGKYKTGPSYTNGVDNTPAVLDYLVKQVKDKKL

    >gi|238028835|ref|YP_002913066.1| Glutathione-disulfide reductase [Burkholderia glumae BGR1]
    MEYDYDLFVIGAGSGGVRLARISASLGARVGIAEAERIGGTCVLRGCIPKKLLVYASHYRGEVEDAAGFGWRFGPGEFSW
    PTLIAAKDREIGRLSGLYVKLLTDAGVTLHEGRATIVDAHTVEIDAQRVSARHIGVATGSWPTLPEIPGIEHAITSREAL
    DLPELPGRVAVVGGGYIAVEFAGIFNGLGSQVDLFYRGEEILRHFDDDLRRVLHEEMVKRGVAIHTHAKVRAIERGTDGA
    LTLDVNGTPHGPYDAVLYATGRHPNTAGLGLENVGVECEAGGAIRVDAYSATNVPSIHAIGDVTSRPQLTPVATRDGALL
    AANLFGGRRTEADHRAIPSAVFSQPELATVGLAEHEARAQYGAVDIYQTSFRALKHTLSGRDEKIFMKLVVVRDSQRVVG
    AHMIGPDAAETIQGIAIAVRMGATKAQFDETIGIHPSAAEEFVTLRTKAPDPA

    >gi|238028947|ref|YP_002913178.1| Putative thioredoxin [Burkholderia glumae BGR1]
    MPALNLDTDADRIAERLRDPDALLVACLCAEWCGTCRDYAGVFERLAAAHPQACFVWIDIETHADRLDEFDVENFPTLLI
    EDARAVRFFGTVLPHGAIVERMLADLTAIPGVAHAPKLRNLLDVAV

    >gi|238028955|ref|YP_002913186.1| O6-methylguanine-DNA methyltransferase [Burkholderia glumae BGR1]
    MPRRENVAFFETPAAAREAGFRPCKRCQPEREPREIEIVRRACAVLDASDRATLAELSAAVHVSPFHLQRLFKRVVGVTP
    RQYQAARRGAALRDALQGGAAVTRAAVDAGYQSASRVYEAVPRELGMAPSDFRRKGAGLRIAYATAPTPLGYVLVGATER
    GICQIAFGDAIAPLVDALAAAFENAECVAAPERLAPFLAQIDAYLRGASEQVALPLDISATAFQQRVWEALQKIPYGQTR
    SYAQIAEAVGSPRAVRAVANACASNPVALAIP
    CHRVVQKSGALAGYRWGAARKAALLAAEARHAAGSPAEPSLDDAA

    >gi|238029012|ref|YP_002913237.1| Protein-disulfide isomerase [Burkholderia glumae BGR1]
    MSGSDTVRAAGQRPPRAVSLVPAVNPADPNLEPGLAALQASLHARYPATRFRQISPTPATGIYEVVMGDKVAYTDVTGRY
    FLFGHLFDMVTQQDLTVPLEQALQKVRFPADRLQDAFVEVHGDGHRKVAIFDDPD
    CPYCLSLEAELAALKDVTIYRFLYP
    LESIHPRARAHAIGIWCADDRLGAWHAWLPVALSRWMRDHGPSVIGAAGQRKAPPAPARVEPKLASCDNPIDRNEALAAS
    LGINGTPSLVSVDGRVMPGAATAEAIDQWLGAN

    >gi|238029053|ref|YP_002913278.1| As reductase [Burkholderia glumae BGR1]
    MSVIIYHNPECGTSRNVLALLGEAGEDLKVVEYLQSPPDRATLERLIADSGMDVRDAMRIKGTPYKELGLGDPSVTASQL
    IDAMLDHPILINRPFVVTPRGTRLCRPSDAVLDLVESLPDRDVLKEEGVPFIVAREITGGDAGLSTALAHAGLPVDDLAE
    SGRRFFEFTTLGGSRVGYGGFEQYGSDVLIRSVTVEPSWRSKGVGRNLVALLLRHAFDAHARVAWLLTTDAQAFFEKAGF
    KLSSRDTAPAAILATRQAVELCSATAFLLSRPITL

    >gi|238023414|ref|YP_002907647.1| hypothetical protein bglu_3p0200 [Burkholderia glumae BGR1]
    MRALIRPLVSALMAVCTAYTALAAPRAQANDLDYPSAWQCDGQAKFNWYCDDDDKPAAPAVASAAAPADPDDFSRFKTAD
    EMRAALKHRLDIATMDPTEANVKSYKRLELYVMAKSATYADVSRRVVWQNPDLDYSLKRPTNNVAVHTYDQARDNDQDAQ
    LRALAEKHGLIFFFRHD
    CPYCHALAPTIRLLADRYGIDVLPVSLDGQGIPGFPNPTADHGQASIWEVQQVPALFIASKET
    GDHAMIGSGVLSLQDIVDRIFVLTATKPGELF

    >gi|238028694|ref|YP_002912925.1| hypothetical protein bglu_1g31580 [Burkholderia glumae BGR1]
    MMPRPIPSTRRRWLAACAAAGALLLGGCSRQPAFENLDITGNTQFGQDFALPDTTGRTRTLADYKGRAVVLVFGYTHCPD
    V
    CPTTLAELAQARQQLGAEGKRVQVLLVTVDPERDTAPLIAQYVAAFDPSFVALRPAGEAQLKQVAKDFRIYYAKSPGKT
    PDGYTMDHTAASYVFDPAGKLRLFVRDGQGPAPWVHDLRLLLG