Burkholderia cenocepacia MC0 3 uid58769

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170731394|ref|YP_001763341.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIRASQINACANCLNMHTVEAREQGETEQRIYLLSAWREAPCY
    TDRERAALGWTEALTRLSEGHAAHAAAYAALNDHFSEEEQVKLTVMINVINGWNRLAVGFGLWVDPADAKAAAAKMVA

    >gi|170731493|ref|YP_001763440.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia MC0-3]
    MTDAKRPHDPRHRHAGGADACCADARDTQTATIADAVSAAGEHAHGHDHDHGHGHDHAAHGDTGHAHDHGHAGDDQHVHG
    ATCSHDHAAHDHAGHDHDHDHDHDHDHDHDHTAGDCCAPAALTLAPLPVAQATASGHVRSAFRIMQMD
    CPTEETLIRKKL
    GGMSEVSALEFNLMQRMLTVEHVAGAQPAIESAIRTLGMTPEAATAGAPAARVVDAPAKPWWPLALAGVAAIASEGATWA
    GLPVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARN
    AIQGLMQLAPDTATVQQADGAWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAG
    TINESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLVAVVPPLVMGGAWHDWIYRAL
    VLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRH
    LGASLAARSDHPVSQAIAAAARDAGTTAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDALERQ
    GKSVVVLVDETHVLGIFAVADTIKDTSRDAIADLHALGIRTAMLTGDNQHTAQAIAQQAGIDDARGNQLPEDKLAAVEEL
    AAGGAGAVGMVGDGINDAPALARVDIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKV
    VFLGLTVAGLGTMWMAVFADAGASLIVVANGLRLLSSSGAFGGAPAKR

    >gi|170731711|ref|YP_001763658.1| protein-disulfide reductase [Burkholderia cenocepacia MC0-3]
    MFNGMALSVRVRALRFLAVLLSFVLVLGGLSAARAADDFLDPSVAFKFSASESPGQVDVRFKIANGYYMYRERFAFAVKS
    GQATLGEPQFPAGHVKFDQTFQKNVETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAAAS
    SGDTTAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFGVLLTAFAISLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAAL
    WIVWPVLAGALKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATLLVGLAAGSTDPVKPLAVLAART
    VASGGAATAGAAAAQDGPAFASVRSSGELDALLKTSGQPVMLDFYADW
    CVSCKEMEHLTFTDARVQARLAKLHLVRADVT
    ANNPDDQALLKRFNLFGPPGIIFFDRNGNEIGRVVGYQAADTFLRSLDRAAVPTV

    >gi|170731778|ref|YP_001763725.1| glutathione S-transferase domain-containing protein [Burkholderia cenocepacia MC0-3]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|170731833|ref|YP_001763780.1| glutaredoxin-like protein [Burkholderia cenocepacia MC0-3]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEF
    IGGSDIMMEMYQSGELQQLFAAA

    >gi|170731851|ref|YP_001763798.1| protein-disulfide isomerase-like protein [Burkholderia cenocepacia MC0-3]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGD
    LVDAKTHKNLTDARLSEINKIDFASLPFANAIKIVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STAKSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTTALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|170731889|ref|YP_001763836.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MIQVGDALPDAQLFEFIDDAREGCTLGPNAYSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAA
    SVLATLTF

    >gi|170731923|ref|YP_001763870.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVI
    VVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYD
    AALAALK

    >gi|170731925|ref|YP_001763872.1| ribosomal protein L11 methyltransferase [Burkholderia cenocepacia MC0-3]
    MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQHSRVVALLSADHEPAVLLAAA
    ANEIGLAETPKFVVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILAKKCGANPVIGIDIDPQAVESARQNSERNRAEVTYGLPDACPEGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|170731929|ref|YP_001763876.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MMMKRMLALAVVAAAAVAGGIAAGHWFRGTADDGVAVAAPTAHGNPVDQLWASSLTGVDGKPATLAAFKGQKVVVNFWAS
    W
    CGPCVEEMPELVALSHQYKQKGIRFIGIGVDSEQNVKNFLQKVKVDYPVFVSGYAGADLARNFGNTAGALPFTVVIDET
    GKIRETKLGQIQPAELKKTLDAL

    >gi|170731997|ref|YP_001763944.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MECKVSWMGQDGMAFSAETGSGHLVTMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKKSRQEVSGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA

    >gi|170732001|ref|YP_001763948.1| iron-sulfur cluster insertion protein ErpA [Burkholderia cenocepacia MC0-3]
    MNAVTETAATTTDMPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|170732110|ref|YP_001764057.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|170732134|ref|YP_001764081.1| peroxidase [Burkholderia cenocepacia MC0-3]
    MSLRLGDIAPDFEQESSLGTIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDGVESHKGW
    INDINETQSTVVGFPIIADADRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLTITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|170732171|ref|YP_001764118.1| DSBA oxidoreductase [Burkholderia cenocepacia MC0-3]
    MTTAPTPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSPAQVD
    QMLRQVTDAAASVGLRYDLPGTLVGDTLDGHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALTEFAVEAGLERAA
    VEAVLHSDAYRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADAFAQALDQAWRDGIVALDGSDAAACGPDGCELP
    ARS

    >gi|170732234|ref|YP_001764181.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MQILTPAMLAEWLGDTARPAPVVLDVREPWEIATAQIAGSVAIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|170732287|ref|YP_001764234.1| thioredoxin reductase [Burkholderia cenocepacia MC0-3]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLITGIAQGGQLMTTTDVENWPADAKGVQGPELMARFQEHAERFNTEI
    VFDHIHTAKLHEQPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKQKEGVVDIKWDHVLDEVTGEESGVTGLRIKNVKTGATEDLLVQGVF
    VAIGHKPNTDLFQGQLEMKDGYILTKSGLQGNATSTSVPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRYLESLHDKK


    >gi|170732332|ref|YP_001764279.1| disulfide bond formation protein B [Burkholderia cenocepacia MC0-3]
    MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFLAAGIRNWRGVWVLELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVAS
    LWRHRRKLAS

    >gi|170732441|ref|YP_001764388.1| glutaredoxin 2 [Burkholderia cenocepacia MC0-3]
    MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYIDIDTDAALVARYDEDVPVLLLDGAEVCRHRFDDARVRDALAARR

    >gi|170732470|ref|YP_001764417.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia MC0-3]
    MNDVVIIGGSFAGLAAALQLGRARRKVTVLDTGRPRNRFAGHSHGLLGHDHKPPLDILVEARQQLARYPTIRLVDARAES
    VTGAIHDFCVVTDDHESLRARRLILSYGVADQMPDVPGFAESWGTSIVP
    CPYCDGFEVAGQHWGLVWSGPQSYQSARLFR
    DWTDNLTVFADGHDIAPDIQADLAGRNIPAVDGRIVEIAHHQGRIATVNLDTGRNVAVDVLFAQPRNRPSASLHESLGLA
    TVDTPTGIVLKVDERRQTSMPGIYAAGDLATPFLPSVTQASSQGAMAGIFAQQSMVV

    >gi|170732516|ref|YP_001764463.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia MC0-3]
    MKRKLLLGAMAALVAGHALLAQAELKPGAAAPDFTTQASLGGKTYTYSLADALKQGPVVLYFYPAAFTKGCTIEAHAFAD
    AVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSLS
    PDKHVENTLAAVKAWADAHPKQ

    >gi|170732569|ref|YP_001764516.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia MC0-3]
    MKNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERDRLGGTCLNIGCIPSKALIHVADAFEQACGHAGEAALGIRVRTP
    EIDIAKSVAWKDGIVDRLTRGVGALLKKNGVRVLHGEARVIDGKTVEVVSGGHAVRIGCEHLLLATGSEPAELPSMPFGG
    HVVSSTDALSPATLPKRLVVVGAGYIGLELGIVYRKLGVDVSVVEAAERVLPAYDAELVRPVADSLARLGVRLWLGHTVL
    GLDEHGAVRVRAADGAEQTLPADRVLVAVGRRPRVDGFGLETLMLDRNGRALRIDDACRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRQFTPASIPAVCFTDPEIVTAGWSPDDAHAAGVDCLSASFPFAANGRAMTLQATDGFVRVVARR
    DNHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEALQEAALRALGHALHV

    >gi|170732718|ref|YP_001764665.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MSELSVEASIGPVDYLVHFTDGVHQWRADEPASLGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLDEVHVKLAHE
    SGSAGSTIVRRISLDGDLTDEQRERLLQIANACPVHKILTHPITIDTAIA

    >gi|170732836|ref|YP_001764783.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia MC0-3]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGEAEVVTAKNVIIATGSKARH
    LPNIPVDNKIVSDNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTADGVSIAYTDKDGNAQTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKTGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIAANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|170733023|ref|YP_001764970.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MSKIDKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DAEVDLGTAGNAYFLQARLNVKVPGLERDVAQRIVDAAHQT
    CPYSKATRGNIDVEIRIA

    >gi|170733188|ref|YP_001765135.1| thioredoxin [Burkholderia cenocepacia MC0-3]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|170733224|ref|YP_001765171.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia MC0-3]
    MSVEVDRQVPDFTAPATGGDVSLSDLKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLLDADGVLRQAWRGIKVPGHVDDVLKAVQAL

    >gi|170733267|ref|YP_001765214.1| hypothetical protein Bcenmc03_1931 [Burkholderia cenocepacia MC0-3]
    MSFSRSAADAADTLPDLAATLGAPAERAFVTLGDAFHTRLPAAPLAAPYVVGFSDDVAQLLDLPPAIAAQPGFAELFAGN
    PTRDWPAHAMPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQLKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETAAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFYPACRDADDPY
    LALLEAATLRTADLVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLALEREGDAELANKLLETMHASHADF
    TLTFRRLAQISKHDASRDAPVRDLFIDREAFDAWANLYRARLSEETRDDAARAVAMNRANPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQILRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|170733268|ref|YP_001765215.1| methionine-R-sulfoxide reductase [Burkholderia cenocepacia MC0-3]
    MSHDSDDKTFPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKVDYSHGMVRVEVRCNHCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPENE

    >gi|170733300|ref|YP_001765247.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia MC0-3]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|170733386|ref|YP_001765333.1| arsenate reductase and related [Burkholderia cenocepacia MC0-3]
    MAKPHTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLIEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    KTGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFAA

    >gi|170733390|ref|YP_001765337.1| glutathione peroxidase [Burkholderia cenocepacia MC0-3]
    MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDQYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL

    >gi|170733477|ref|YP_001765424.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia MC0-3]
    MGRRGKDIMAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDDLAPEDQVFESHGVKVVVDPKSLAYI
    DGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV

    >gi|170733489|ref|YP_001765436.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia MC0-3]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKPAAAAPAPAAAAPAPAPQAGSYSGAADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLG
    GV
    CLNVGCIPSKALLHTSLVVEEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDP
    FHMEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDV
    VEMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGA
    DKAGVAVTDRGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGK
    TEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGAIVGLNAGDLISEVCLAVEMGADAEDIGKTI
    HPHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|170733673|ref|YP_001765620.1| rhodanese superfamily protein [Burkholderia cenocepacia MC0-3]
    MTIVNLAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPFVDARTLKAWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDNALDYRI
    DKFSEFPEVIDANRADLEGKTVVSF
    CTGGIRCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTENVTCFACRAVVTPEAQQSPSYVPGKSCPACAQAASAA

    >gi|170733920|ref|YP_001765867.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia MC0-3]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESMKSVDPDSALAKRAVKQIERYFERASARFDLPLADVGSAFQHRVWDVIS
    DIPPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQQVKRWLLTHEGVPY

    >gi|170733926|ref|YP_001765873.1| thioredoxin [Burkholderia cenocepacia MC0-3]
    MDTTLATFEKDVIEASLDTPVLVDFWAPWCGPCKTLGPLLEKLETDYAGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFVGVLPEGQLRAFLDRLLPAAEEAERRAAQYAMAEQRFDDALAHLDAALALNPGYDDARLDLIELLLARNEVD
    AARAETERLSQQTVQNGDPRYQAIKTRFDALDATADLPPTDALEARIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VTRDRAYGDDLGRRTMISVFELAGDRPDLVAAWRRKLSMALN

    >gi|170733931|ref|YP_001765878.1| peptide methionine sulfoxide reductase [Burkholderia cenocepacia MC0-3]
    MGNEMLETATLGGGCFWCTEAVFLDVDGVTAVQSGYAGGHTRNPGYRDICEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTTPNRQGNDVGTQYRSVVFTHSDAQRDTALDVIAELEREQVFGQPIVTQVVPLDGNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFSHRLKSLRGA

    >gi|170734181|ref|YP_001766128.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia MC0-3]
    MLACAFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCPDVCPTTMAELSEAL
    KQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAALRKVTKDFRVYYAKVPGKTPGSYTMDHTAAS
    YVFDRDGKLRLFVRDGQGPAPWVHDLKLLVD

    >gi|170734200|ref|YP_001766147.1| glutaredoxin 3 [Burkholderia cenocepacia MC0-3]
    MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLV
    PLLQAA

    >gi|170734201|ref|YP_001766148.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MTFFTNYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAAADFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVEAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|170734204|ref|YP_001766151.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia cenocepacia MC0-3]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAASGVGTLTLVDADTVDLTNLQRQILHVTASVG
    RSKVESGRDTLAQLNPEVTVNAVAERVDDAWLDAHVPHASVVLDCTDNFATRHAVNRACVAHGVPLVSGAALRFDGQIST
    FDFRDAAAPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGKTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCGGRH

    >gi|170734215|ref|YP_001766162.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MNTTPPARRSTGPVRYIVAAAVVAAIAVAGFFAFNGKSSVPDATFTLLSGQKVSTAGDLKGKVYLVNFWATSCATCMQEM
    PQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKDGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|170734269|ref|YP_001766216.1| DSBA oxidoreductase [Burkholderia cenocepacia MC0-3]
    MKKLLSTLLLSLGLAAGLAQASPAAPASGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNID
    FKRVPVAFRDDFLPHSKLFYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKKFMDAYNSFSVQGEVN
    QSAKLLKDYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDFLVKQVQDKKL

    >gi|170734358|ref|YP_001766305.1| glutathione-disulfide reductase [Burkholderia cenocepacia MC0-3]
    MDFDYDLFVIGAGSGGVRLARMSASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHEVDDAKGFGWTFGAGTLDW
    SALIVAKDREINRLSDIYINLLRQSGVDMHAGRATLVDAHTVAIGERTIRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLAALPKRIAVVGGGYIAVEFAGIFNGFGSHVELFYRGEQILRGFDDDVRQFLTDEMTKQGVTIHARAVIESIERADDGT
    LFVQVGDARHGPYDQVLYATGRVPNVDGIGLEQAGILLDARGAIAVDAYSATSVPSIHAIGDVTSRPQLTPVATRDAGLL
    ARTLFGGSRVAVDHAYVPSAVFSQPEVATVGLTEADARRTLGDVDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGREAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTMRQKVAD

    >gi|170734478|ref|YP_001766425.1| thioredoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MPALNLDTDADRIAERLADPGTLLVACLCAEWCGTCRDYRSAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDAHTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRDILNVEA

    >gi|170734503|ref|YP_001766450.1| AraC family transcriptional regulator [Burkholderia cenocepacia MC0-3]
    MKTAYPTDDARWGAVTKRDPHADGAFFYAVSTTGVFCRPTCASRQPRRENVSFFADPAAARAAGFRPCKRCQPEGLPREL
    EIVNRACAVLDAHAERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQRGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYATASTSLGTVLVAATEQGICRIAFGGDAASLVGELNDTFARAELVEASARLA
    PFVTQIRAYLDGTRQAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGAPRAVRAVASACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLAAEAHHVHNDEAEAETEGSAV

    >gi|170734524|ref|YP_001773638.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia MC0-3]
    MTGSDASSRPDLTQGIALDDLADGAMIEGHVGDAAVLLVRRADELFAVGAQCPHYGGPLAQGLLVGDTIRCPWHHAAFCL
    RTGEMERAPALDGLPCWRVERRDGRAVVVDARPAAVPPALKETGLPSSVVIVGGGAAAIAAAVTLRQEGYPHAITLLSAD
    ADPPYDRPNLSKDYLAGTAEADWLPLRAPSFYAGQRIDVRCNTRVTRIDPARRSVELADGSRVEYGALLLATGAEPNRLN
    VPGADLPHVCTLRSRAD
    CDALIAKLKTARRCVVVGASFIGLEAAAALRTRGLDVHVVAPDPHPMGRVLGDALGDTIKALH
    EAHGVVFHLGTTPARIGPDNVTLSNGDVLPADVVLVGIGVHPNVELAQEAGLAVERGVTVDRFLQTSAPGIYAAGDIARW
    PDPLTGERIRVEHWVVAERQGIVAARNLLGQQRPFDAVPFFWSQHYDLTLRYVGHAEQWDRVEIDGDLGAHDCSVAYWRG
    NTRLAVVTIARDLDNLKAEAALERQTASA

    >gi|170734615|ref|YP_001773729.1| thioredoxin [Burkholderia cenocepacia MC0-3]
    MSNLKAVTLETIEADVINNPLPVLVDFWAPWCGPCKALAPTLSKLSEQFEGNVAFVKIDVDENAGVRERFGVRGIPTLIL
    LRDGKELGRVVGNRSATQLAGFIDNHLGSVTALPAAIAVAPNAFGGNAQLKTERLAALRVWLDRKRAAPSEAMWDGEIGS
    AIQFVCNTADVDDCARTLGIPANVLAVVESLSSYRSTHLNGAEFVAQWLDAVPVGANLARLPQMLVTDLLSGGEMSELIG
    DDAALLSIRDRLVAQHDPARAAGPLDSELAAIKQALAKADAAAAGAAHALATRLLVLVAQPLGDAAIVTDFIFGLAGAHW
    ELLRAACNWTRDDDRRFMQLAEETSNRAVERGEEASQGDKTLERIGLVDSELIARFRSHYGEGTQAMKEVGTRIGDRLIA
    ITQRCA

    >gi|170734683|ref|YP_001773797.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGVREIRIRDFQVISDSPPDFAGYNLGPASPELQLGVL
    GS
    CLTHITLIQAAERGLKIDAIEVEVTGDQHPLAQQPGFEHVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNL
    LRLPQHIDGELRHTSA

    >gi|170734790|ref|YP_001773904.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia MC0-3]
    MNDVIIIGGSFAGLAAALQLGRARRKVTVLDTGRPRNRFAGHSHGLLGHDHKPPLDILVEARQQLARYPTISLVDARAES
    VSGAIDDFCVVTDDHESLRARRLILSYGVADQMPDVPGFAESWGTSIVP
    CPYCDGFEVAGQHWGLVWSGPQSYQSARLFR
    DWTDNLTVFADGHDIAPDIQADLAGRNIPAVDGRIVEIAHHQGRIATVNLDTGRNVAVDVLFAQPRNKPSASLHESLGLA
    TVDTATGIVLKVDERRQTSMPGIYAAGDLATPFLPSVTQASSQGAMAGIFAQQSMVV

    >gi|170734829|ref|YP_001773943.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MISLPFSENPVSRLPLPTIETAPAASQPFLEKSQRANGFLPNLVRSLANAPVALETYLTVAEINGRAGLTFAEREAVQIT
    AAAVHGCAF
    CVAGHTAAALKKAQVERADVDALRDGEPVAEPRLEAVATFTRAVIATRGAVTDDALAAFLAAGFTEANALE
    VVLGVSLATLCNFANNLARNELNPELAAYRWEPRTQAA

    >gi|170735114|ref|YP_001774228.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRDIAQTLIDRAHVV
    CPYSNATRGNIDVTLTLV

    >gi|170735214|ref|YP_001774328.1| peptide methionine sulfoxide reductase [Burkholderia cenocepacia MC0-3]
    MIPIPTCDAAARRRAVMLRRIGAIAVAAAAVFGYQRIVNSAEPMRTVPAATLDETPGASHDETAVLAGGCFWGVQGVFEH
    VKGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTQLNRQGPDEGSQYRSAIFP
    TTAQQRAVATAYIAQLGAAHAFPAPVVTRVEAYKGFYPAEAYHQNYLELHPDAPYIAFNDLPKVAGLKQTFPALYRTDPV
    LWREARS

    >gi|170735215|ref|YP_001774329.1| cytochrome c biogenesis protein transmembrane region [Burkholderia cenocepacia MC0-3]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAGMALTFAVVATLAAVGGGWVAQANQAGRWIAIVLLA
    VFGLTLLMPRFAEHLTRPLVATGNRLTGFAQRDGRAAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQLSTVTTGGLETKLVARLG
    GRSNGAPAATAAPGATDNVAGGAMMAAAADGAQAGEGAMAGSAMMRAVGAIPSALPVEGTLPSLDGAVQWLNSPPLTAAG
    LRGKVVLVDFWTYS
    CINCLRTLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYSIWRA
    FNNEYWPAHYFIDAQGRVRHHHFGEGEYVQSERAIQSLLAEAGHPDALNVPLGLAGAPAKGALAAADSADVRSPETYVGY
    ARAESFASPGGVVRDAAHRYDAPAQPDLNGWGLAGTWSVGAERAALAAPDGRIVYRFHARDLHLVLGPGTNGRPVRFRVT
    LDGTAPGAAHGADVDAQGYGTVTGQRLYQLVRQPGAIADRTFAIEFLDPGVDAYAFTFG

    >gi|170735216|ref|YP_001774330.1| methionine-R-sulfoxide reductase [Burkholderia cenocepacia MC0-3]
    MPTRRHLLFAGATGLAALAALSSAGRRALVGRAFAAPPAGSSKAAPFEITLSDAEWHRRLTPAQYTVLREAGTERPFTSP
    LNDEHRHGTFACAGCDLALFSSATKFDSHTGWPSFWKPLDHAVGTDTDASFGMVRTEVHCRRCGGHLGHVFDDGPAPTGL
    RY
    CMNGLALAFHPAVA

    >gi|170735638|ref|YP_001776898.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MQPRLNFYAASPNAIKVMRNAEEFLAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETERRLATVVTWRETPF
    FTERERAALEWTEALTLVAGNHVPDAVWEAVKPHFTDEELFDLSMLIATINSWNRFAIAFRKMPE

    >gi|170735643|ref|YP_001776903.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MTQSADSISRFPVASYQDVRARLLARDEIALIDVREEDPYAQGHPLWAANFPLSKLELDAWTRIPRRDTPIVVFGEAGGE
    DLAPRAAATLARLGYTDVRLLDGGLAGWVAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQALIDAKADVVIVDAR
    RFDEYQTMNIPTSTSVPGAELVLRVRALAPDPRTQVIVN
    CAGRTRSIIGTQSLVNAGLPNPVAALRNGTIGWTLAGQTLE
    RGAARRFPDEIDATQRAEARQAARAVAERAGVPRIAFEDVAALDEPGRTLYRFDVRTPEEYEAGHLPSFLSTPGGQLVQE
    TDHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPGGTAAFSERGHPPRDVPATPPAADVSPATLAGWLKEAAP
    GELAIVDVTASANYVKRHIPGAWFAVRAQLRDALAAIPPAKRYVFTCGSSLLARFAADDARALLPASAEIRVLTGGTAAW
    IDAGLPLENGETHLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRDGTHHFNVI

    >gi|170735752|ref|YP_001777012.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia cenocepacia MC0-3]
    MQVDTLHFTPWLSLAGGVLIGLAAAGLVAFNGRIAGISGIVGGLLTAAGSERGWRAAFIAGLIAAPVAMRFAGSGLTPQI
    DASWPELLGAGLLVGVGTRYAGG
    CTSGHGVCGISRGALRSVVATATFMAAGFATVFVRLHVPGG

    >gi|170735815|ref|YP_001777075.1| peroxiredoxin [Burkholderia cenocepacia MC0-3]
    MPIINTQIKPFKATAYHNGEFVPVSEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIAKIKYPLVGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|170735816|ref|YP_001777076.1| alkyl hydroperoxide reductase, F subunit [Burkholderia cenocepacia MC0-3]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYAFETFFSLS
    CQNCPEVVQALNVMSLINPRIRHVAIDGALFQ
    DEVESRQIMAVPTMFLNGASFGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIVLATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDVAAPAATAQSQVEEAVAA

    >gi|170736034|ref|YP_001777294.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAYAAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    LATLLASRGLKQGQQVVAYDAQGGAYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPVAGDFRSATPLEST
    VDAAAVLANVSSPARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGHELREAFATVLAGTEPNRV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPNP

    >gi|170736045|ref|YP_001777305.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKNDAQVLVDKAHHV
    CPYSNATRNNVPVRLTVV

    >gi|170736107|ref|YP_001777367.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MSLIHAAAVLDADAPDYVVQLQAGTHTLTGDEAPREGGQDRGPAPYEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTE
    LHADREGVQYVRRVVTLDGPLDDAQRQRLTEICEKTPVTQFIKRGTRIETTLN

    >gi|170736253|ref|YP_001777513.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia MC0-3]
    MTQHFDAIVIGTGQAGPPLAARLAGAGMKVAIIERGRFGGTCVNTGCIPTKTLIASAYAAQLARRASEYGVSVGGPVTVD
    MKAVKARKDQISGRSNHGVEQWVRGLDNTTVFQGHARFERANAVRVGDDVLEAERIFVNVGGRAQVPAMPGLDSVPYLTN
    STMMDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSQVTIVEKGPRLIRREDEDVSQAVREILENEGIDVQLDANCLSARRD
    GDGIVVGLDCAGGGREVAGSHLLLAVGRVPNTDDLGLDRAGIATDARGYITVDEQLRTNVPGIWALGDCNGRGAFTHTAY
    NDYEIVAANLLDDDPRKVSDRITAYAMYIDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDAD
    SHAILGASILGVTGDEVVHGILDVMTAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|170736322|ref|YP_001777582.1| uncharacterized peroxidase-related enzyme [Burkholderia cenocepacia MC0-3]
    MTTATHGFTSDTLGWRAWLDTVSLDTATPEQLAVLEASHPQAKTSDYYLLLVHLPEILRQRSGVFNAIMYGPGGLSRAER
    ELASTAVSRVNGCVY
    CASVHAQRFAQLAKRTDAIEQVFDDPATAGTTARERAIVRYAIALTERPDAIDESDIAALEAEGL
    THEEILDLSHAIAIFAWANRLMLTLGEPVFPESAAGA

    >gi|170736330|ref|YP_001777590.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia MC0-3]
    MDTHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGRPRNRFAEHAHGFFGQDGKPPARIVAEASAQLAAYPTVQRIDGE
    ARTAERDANGRFHVTLADGSHASADRLILATGIRDELPALPGLAERWGISVLH
    CPYCHGYEVSGQRLGVLATHPLSVHQA
    ILIPDWGPTTWFTQGVVEANEEEAALLAARGVRIERSPVVEILGDAPRIDALRLADGQLVSIDALFIGARTDMASDLAQQ
    LGCAFDEGPLGTAIRVDTWKQTSVAGVYAAGDASSLMTNATFASASGVAAGVGVHRSLIFGLNA

    >gi|170736386|ref|YP_001777646.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MTVELQERTAAQQALEDARAAALAAGKPYAGGVAPETAWALFSAGDAVLVDVRTAEERKFVGYVPESLHVPWATGTSLTR
    NPRFVRELEAKTGKDAVVLLL
    CRSGNRSAQAAEAAAKGGFTQVFNVLEGFEGDLDERQHRGGQNGWRFRGLPWAQD

    >gi|170736453|ref|YP_001777713.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia MC0-3]
    MTPAHLIPSPLGDIAVRIEDDALTGLYFVGQKYFPSLAILNDAHTLATSPIARRVAEEIAEYFTGARDTFSVPIHLRGTA
    FQRRVWQELLAIPFGELVSYGDITERVGLPMSGARAVGGAVGRNPVSIIVP
    CHRVVGASGSLTGYAGGIERKRALLSLEG
    AELSRGAHHPMQQALAF

    >gi|170736531|ref|YP_001777791.1| hypothetical protein Bcenmc03_4150 [Burkholderia cenocepacia MC0-3]
    MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITASFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVF
    LRDGVEVARVVRPADAKQIEADGFAALA

    >gi|170736567|ref|YP_001777827.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MLSIGPFSIRVAAVAVAALLAWLVARVIQRRPPDGHHKSASSLILDVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDG
    GFDARIGIAAALVFAGWRLRRLPALRRPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPV
    VVNLWATW
    CAPCRREMPILEQAQRDHPGITVLMLNQGENAHAVRAFLEQQSLRFDHVLLDPSLHAMHAYGSRGLPTTLFF
    NAKGELVESHMGELTAARLKDAITQRFGQ

    >gi|170736589|ref|YP_001777849.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MLSIGPFSIRVVAVAVAALLAWLVARFIQRRPPDGHHKSASSLILDVLLLGLIAARVGYVAQWWPDYAATPRAIVALGDG
    GFDARIGIAAALVFAGWRLRRLPALRRPVLAGIVAGLSAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPV
    VVNLWATW
    CAPCRREMPILEQAQRDHPGITVLMLNQGESAQAVRAFLEQQHLRFDHVLLDPSLHAMHAYGSRGLPTTLFF
    DAKGELVESHMGELTAARLKDTVTQRFGQ

    >gi|170736806|ref|YP_001778066.1| OsmC family protein [Burkholderia cenocepacia MC0-3]
    MTTHPNGIDVPALQQFVQEVATDPTKRNARFNVKTKWAHQTRSVATVSHYELGGVTHQRHFEIAADEPTQLLGTNSAPNP
    QELLMAALNA
    CLTVGYVVNAAAMGITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHRVVT
    KTSVNRANFSKAIRVVSTLEVREG

    >gi|170736808|ref|YP_001778068.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MENWTETIGAVTRRVHELARYTPDTIKGVGLLGAAGAKTNHLDAKTRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEE
    VAEALGVAINLNAGAAVVYSTHVLDALDQLGRE

    >gi|170736809|ref|YP_001778069.1| DSBA oxidoreductase [Burkholderia cenocepacia MC0-3]
    MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGMAQHVDVVVTHKSYRLARGMVPTGFTDALYAKFGNPAAAQRMMDAVCSAG
    AQEGLNYRFETMRFGDTSDAHLLVKSVQKPEDKQRLIEAIYRAATTDGVDIFDRAALVELAKNIGISAASLSFDDREMVS
    EIARDEAKANRIANGVPLFVFNNRTYLSGAREVAVFEKALIDSAENVPDESADTGGMSCSIDGCAG

    >gi|170736914|ref|YP_001778174.1| arsenate reductase [Burkholderia cenocepacia MC0-3]
    MMITIYHNPRCSKSRETLALVESLNTAGAPLNVVEYLKTPPTVEELETLHRQLGRPVRDMLRDGEEPYKTLNLARADLTD
    AEAYAAIVAHPILLQRPIVVYRGKAAIGRPPESVKGLFE

    >gi|170737096|ref|YP_001778356.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MLRDLVAQYGPLLVFANVLAAAVGLPVPAMPTLVLFGAMSAMHPAMIGSQLVTVVALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLGAGLVFY
    RQIDWLFAGASRLGRAVLLVIVALLAVYAAVRWMRRRALIRQLANARIGVDELDVLLRDAAAPVVLDVRSPEHRKLDPFT
    IPGAQFADERQIGDIVARYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALALRGGLDAWRDTGRQLTSLVEEMPAAN
    DPVAGWHKPA

    >gi|170737100|ref|YP_001778360.1| thioredoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MKTVLRNLTAACLFVAAGAALAAATPAGAPVASASPDGAHLPPGIAWQHGDVDAAFALAKREGKPLLLYWGAVWCPSCNQ
    VKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTAAHP
    VRQTLATALKNGASLTPDEWRLLADYSWDTDGALPVPADRVAETLQSLAQRARAAGAKAESARFALKSAVVAASDDPTQA
    GALDKAALADSLRTVLHDAALSRADSDVLVAAPARVVAYLGGDDAQRSKLRGAYDTALARLSTDTTLSSIDRLMALHGRV
    LLARGDARKGTPLAAPALADTARKQIAASVQGAANAYERQALVSEGADTLTDAGLYDESDALLKAELPRSSTPYYFMSGL
    AANAKARGDKAAALDWYRKAYDAASGPATKLRWGATYFANAVELAPDDSARIEGIAASVLAQADKTRDAFYGANLRALTK
    VVTQLNRWRGSGAHDASVRSVVKQFDGVCGKLPAGDPQAAACTKLIQPVKA

    >gi|170737137|ref|YP_001778397.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia MC0-3]
    MTEPLASAALQTIELSVDGMHCGGCTGRVQRALAAVPGVVDAAVDLDAHTATVTAQETVEPDQLVDAVREAGYGAAVREA
    AGEAVAPTHVAHATPDATPSAPAAATTIELDIDGMT
    CASCVSRVEKALVKVPGVTRASVNLATERATVDASAGVSATQLA
    DAVKQAGYGATPTASDTDVPTLPTVPASIELDIDGMT
    CASCVSRVEKALAKVPGVTRASVNLATERATVDASNDVSAAQL
    VDAVKQAGYGATPATVAAPPATPASADVELDIAGMT
    CASCAGRVKKALAAVPGVARATVNLATERASVHGAGALDAATLI
    AAVTTAGYRASLPAASPASATAGADLQPASPAQDPDARKRREAIRERNLVIGAAVLSAPLVAPMLAAPFGIDLMLPGWLQ
    LVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFEASAVIVMLVRFGKWLESR
    AKRQTTEAIRALNALRPDRARVVEHGVERDVPLSQVRVGTRVGIRPGERVPVDGRIVSGRSHIDESLITGESLPVPKDDG
    DAVTAGSINGEGALVVETTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLVGWLIAGAGMETA
    ILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVTAFDAVGVPRAE
    ALALAAAVQRQSDHPLARAVVAAHDADVAAQGGAAESVVATDARAVAGRGVEAHVGGQRLALGSTRWRDELGIAVPPALD
    ARAAELERAGNTISWLMRADAPRAVLALIAFGDTVKPGARDAIAALSARGVASALVTGDNRGSAAAVAAALGIGEVHAQV
    LPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDISKRTYRKIQ
    QNLFWAFVYNLVGVPLAALGLLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|170737157|ref|YP_001778417.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia MC0-3]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALLDELGLRLVATIDTHVHADHVTGAWLLKQRTGSAIAIS
    AASGAHGADRYLNDGDRCAFGPRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDAQAAA
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFAGPLGHLPGATPIPLGELAARTGEIAHDRPVVTV
    CRAGGRSA
    QATVILKKAGFDAVANLGGGMLRWRAEGRVVMDGRS

    >gi|170737228|ref|YP_001778488.1| uncharacterized peroxidase-related enzyme [Burkholderia cenocepacia MC0-3]
    MTASDNAPVSRFPVPALEDLPDDIRARIATVQEKSGFIPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLSKAEREMIVVA
    TSAANQCQY
    CVIAHGAILRIRAKDPLIADQVATNYRKADITARQKAMLDFAMKVSRAAHQVGEPDFDTLKTHGFTEDDIW
    DIAAISAFFGMSNRIANVTNMRPNAAFYALGR

    >gi|170737272|ref|YP_001778532.1| selenide, water dikinase [Burkholderia cenocepacia MC0-3]
    MTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGLAAI
    GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPGAELAALPGVHALTDVTGFGLL
    GHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTGASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVACAP
    EAVDDVLACFRADGFDRAAVIGEMVDGPARVDVA

    >gi|170737377|ref|YP_001778637.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
    MLPRFKTAALVIALAATAGLAAFAGTRDDAGVQASPAGMTAPAFTGIDRWHNSAPLTLDQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDAKNVADAIKRFDIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIRGALAQAGEGAKGSTRTQ

    >gi|170737433|ref|YP_001778693.1| alkylhydroperoxidase [Burkholderia cenocepacia MC0-3]
    MTARINTPAAAAATGATADVFATIRKAVGMVPNAYAAIGALNTPALQAILSADAVLSKGSLSAQDCETIKLVVSAISGCD
    Y
    CVAAHSLASKASGIAVDAVRAIRALEPTGDARRDALIRFIRVLQESRGTIASEELEAFRSAGYSDESVVDVALAIALIT
    FTNVFNRVNDTVVDFPALK

    >gi|170737452|ref|YP_001778712.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia cenocepacia MC0-3]
    MSDVKHYEYLFLGGGKGGKTLAMDMARQGRRVALIERGMIGGSCINVACIPSKTLIQNARQVHGWREAAGDASIMADMAN
    VSENVRGVVDGMIKINRAAFEKSGLDLITGTGRFIAPRTISVRTEDGSEAIYEGENVYINTGTVAQIPNVPGLRDAQPLT
    HVEALRLDELPEHIVVIGGGYIGLEMSQAFRRLGSAVTLIHDAPRVAMREDEDVSREIQQALEADGIKLELQSRIANVRG
    TSGQQVTIELADGRVVEGSHLLVTTGRKPQTDAIGLDLAGVEVDGRGIIKVDEKLATTAPRTWAIGEIAGTPMFTHASFD
    DYRVLKAGIEGRSVSTANRTIPYALFIDPELGRVGLNEADARAEGILVRVAKLPMAAVPRARTNGNTRGFMKALIHPETD
    RILGFTMVGAGAGDVTTAVQMAMLGGLSYRAVRDSIIAHPLLSEGLNLLFATLD

    >gi|170737583|ref|YP_001778843.1| methylamine dehydrogenase accessory protein MauD [Burkholderia cenocepacia MC0-3]
    MMQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGTIAPTFELTDMRGAQVKVGGIDAAGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQASEATPVNIVLASDGDADEHTRFARKHDLGRFPYVLSQELGLAYQIGKLPYAVLLD
    ETGTVRAKGLVNTREHLESLFEAKERGVASLQQFVLGDHSHDAHDGHAQHA

    >gi|170737729|ref|YP_001778989.1| rhodanese domain-containing protein [Burkholderia cenocepacia MC0-3]
    MSHVTDVPAAGSAAALAHFEASLRFETDCWDVHDAFASGTPDFVLLDVRGPDQFAAGHVPGARNLPHRKIIESKLAGYPA
    DTLFVVY
    CAGPHCNGAARAAIRLARLGRPVKLMIGGVTGWLDEGFALSNDVQPANAEAA

    >gi|170738336|ref|YP_001779596.1| uncharacterized membrane-associated protein [Burkholderia cenocepacia MC0-3]
    MWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWVSMFAAAIGATMLADSLWFFMGRTRGRRLL
    NGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGIGVFLFWDLAGASLWAAFWLIGGAAIHD
    QIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSDEPPLIFDARPKAIRDREPYRI
    AGAVPVDLDSPDLLDPEVLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMIHNIRALKGGLDAWEKHGYPVEPLPADLDSSRY
    FVRPDHGGLEGEYTVRATLSK

    >gi|170732073|ref|YP_001764020.1| hypothetical protein Bcenmc03_0720 [Burkholderia cenocepacia MC0-3]
    MVPAGVDPAAFDAFDMQALDAGTFDAAIDGAGDALAVVFFWGVDCFNCEIAKKAMLAQPDAIRALGLKWFHCNVYEHHEL
    GRRFGLHGVPTWFFFHRGKRLGRATGWHGLAQFQAAVAAARGKIAAAADAAAAAAPAGERTGGQHDPLAGGD

    >gi|170732482|ref|YP_001764429.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia MC0-3]
    MSSARPAPHRRLSRLIRTAAALAAAVALTACTHDEPRWNLTNVTGHLPDLSFKLTGGDGHPVDADAFRGRVALVYFGYTH
    CPDVCPETLARLMEVLAKLGPRADDVRILFVSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQMEK
    RDPSGGYEVTHSSAVYIFDATGRARLLATDRDSPDAIAADVRRIIDTASTT