Burkholderia cenocepacia J2315 uid57953

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|206558459|ref|YP_002229219.1| putative heavy metal resistance membrane ATPase [Burkholderia cenocepacia J2315]
    MTDAKRPHDPRHRHTGGADACCAEARDTQTATVADAAPAAGERAHGHDHDHGHDHAAHGKAGHDHDHGHAGDDQHVHGAT
    CSHDHAAHDHAGHDHDHDHDHDHDHDHDHAAGDCCAPAALTLAPLPVARATASGHVRSAFRIMQMD
    CPTEETLIRKKLGG
    MSEVSALEFNLMQRMLTVEHAPGAQPAIESAIRTLGMTPEAATAGAPAARVADAPAKPWWPLALAGVAAIASEGATWAGL
    PVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAI
    QGLMQLAPDTATVQQADGAWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAGTI
    NESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLVAVVPPLVMGGAWHDWIYRALVL
    LVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLG
    ASLAARSDHPVSQAIAAAARDAGTTAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDALERQGK
    SVVVLVDETRVLGLFAVADTIKDTSRDAIADLHALGIRTAMLTGDNPHTAQAIAQQAGIDDARGNQLPEDKLAAVEELSA
    GGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKVVF
    LGLTVAGLGTMWMAVFADAGASLIVVANGLRLLSSSGAFGGARAQR

    >gi|206558670|ref|YP_002229430.1| thiol:disulfide interchange protein DsbD [Burkholderia cenocepacia J2315]
    MFNGMALSVRVRALRFVAVLLSFVFVLGGLSVARAADDFLDPSVAFKFSASESPGQVDVRFKIANGYYMYRERFAFAVKS
    GQATLGEPQFPAGHVKFDQTFQKDVETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAASS
    SGDTAAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFGVLLTAFAVSLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAAL
    WIVWPVLAGGLKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATLLVGLAAGSTDPVKPLAVLAART
    VASGGAATAGAAAADGPAFAPVRSSGELDALLKTSGRPVMLDFYADW
    CVSCKEMEHLTFTDARVQARLARLHLVRADVTA
    NNPDDQALLKRFNLFGPPGIIFFDRNGNEIGRVVGYQAADTFLRSLDRAAVPTV

    >gi|206558737|ref|YP_002229497.1| putative stringent starvation protein A [Burkholderia cenocepacia J2315]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|206558777|ref|YP_002229537.1| putative glutaredoxin [Burkholderia cenocepacia J2315]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEF
    IGGSDIMMEMYQSGELQQLFAAA

    >gi|206558795|ref|YP_002229555.1| thiol:disulfide interchange protein DsbC [Burkholderia cenocepacia J2315]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGD
    LVDAKTHKNLTDARLSEINKIDFASLPFANAIKVVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STAKSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|206558839|ref|YP_002229599.1| O6-methylguanine-DNA methyltransferase [Burkholderia cenocepacia J2315]
    MKTAYPTDDARWGAVTERDPHADGAFFYGVRTTGVFCRPTCASRQPRRENVSFFTDPAAARAAGFRPCKRCQPEGLPREL
    DIVNRACAVLDAQAERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQSGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYATASTSLGTVLVAATEQGICRIAFGDDPASLVGELKDTFARAELVESSARLA
    PFVTQIRAYLDGTRHAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGSPRAVRAVASACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLAAEARHVHDDEAEAETEGSAV

    >gi|206558865|ref|YP_002229625.1| putative thioredoxin [Burkholderia cenocepacia J2315]
    MPALNLDTDADRIAERLADPGTLLVACLCAEWCGTCRDYRTAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDAHTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRDVLNVEA

    >gi|206558986|ref|YP_002229746.1| glutathione reductase [Burkholderia cenocepacia J2315]
    MDFDYDLFVIGAGSGGVRLARMAASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHEVDDAKGFGWTFGAGTLDW
    SALIAAKDREINRLSDIYVNLLRQSGVDMHAGRATLVDAHTVAIGTRTIRARHLAIATGSRPSLPPRPGIEHAITSREAL
    SLAALPKRIAVVGGGYIAVEFAGIFNGFGSHVDVFYRGEKILRGFDDDVRQFLTDEMTKQGVTIHARAVIESIERVDDGA
    LFVRVGDARHGPYDQVLYATGRVPNVDGIGLEQAGILLDARGAIAVDAYSATSVPSIHAIGDVTSRPQLTPVATRDGALL
    ARTLFGGSRVAVDHAYVPSAVFSQPEVATVGLTEAGARHAHGDVDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTMRQKVAD

    >gi|206559075|ref|YP_002229835.1| thiol:disulfide interchange protein [Burkholderia cenocepacia J2315]
    MKKLLSTLLLSLGLAAGFAQASPAAPAAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNID
    FKRVPVAFRDDFVPHSKLYYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKKFMDAYNSFSVQGEVN
    QSAKLLKDYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDFLVKQVQDKKL

    >gi|206559123|ref|YP_002229883.1| putative thiol-disulfide oxidoreductase [Burkholderia cenocepacia J2315]
    MNTTPPARRSTGPVRYIVAAAVVAAIAVAGFFAFNGKSSVPDATFTLLSGQKVSTAGDLKGKVYLVNFWATSCATCMQEM
    PQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKDGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|206559134|ref|YP_002229894.1| putative molybdopterin biosynthesis protein [Burkholderia cenocepacia J2315]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAASGVGTLTLVDADTVDLTNLQRQILHVTASVG
    RSKVESGRDALAQLNPEVTVNAVAERVDDAWLDAHVPHASVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDAAAPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGKTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCGGRH

    >gi|206559137|ref|YP_002229897.1| hypothetical protein BCAL0740 [Burkholderia cenocepacia J2315]
    MTFFTNYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAASDFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVEAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|206559138|ref|YP_002229898.1| glutaredoxin 3 [Burkholderia cenocepacia J2315]
    MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLV
    PLLQAA

    >gi|206559157|ref|YP_002229917.1| putative lipoprotein [Burkholderia cenocepacia J2315]
    MLPSRFGRRARQGWMLACAFTAALLLAGCDNAPKFQNLDITGNTQFGSDFALPDTSGKVRTLADFKGKAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAALKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAPWVHDLKLLVD

    >gi|206559316|ref|YP_002230077.1| putative oxidoreductases [Burkholderia cenocepacia J2315]
    MNSDRVMAIVGAGHAGGRAAQELRACGWRGRIVLIGAEPHPPYERPPLSKGVLTGERSAAQCRLRDAQAWAADRIERIVA
    TVERIESHAREVRVSGGHVFGYDALLLATGGRARRLAVPGAALDGVFALRTLDDAAALGARLVPDARIVLIGGGFIGLEV
    AASARQRGCRVTVLDAAPRLLGRAVPATIATRVHALHDARGVAIRLNRTPVAIERTAGGALAVVLDDGDTLIADTVVAGI
    GIEPADELARDAGLAVERGIVVNAQLETSARGIYAAGDVAVFPSALSGQLVRQETWHGAETQAHVAARNMLGAGEPYRDT
    PWFWSDQYDAQLQVAGEPALGTRSVARVLGDDAEIHFHFDARARLVAASGFGRAAGFVKDMRVARMLVERGTDVTPAAVA
    DVDVKLKSLVTAVNDR

    >gi|206559395|ref|YP_002230156.1| family S33 serine peptidase [Burkholderia cenocepacia J2315]
    MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYIDIDTDAALVARYDEDVPVLLLDGAEVCRHRFDDARVRDALAARR

    >gi|206559457|ref|YP_002230218.1| putative redoxin protein [Burkholderia cenocepacia J2315]
    MKRKLLLGAMAALMAGHALLAQAELKPGAAAPDFTTQASLGGKTYTYSLADALKQGPVVLYFYPAAFTKGCTIEAHAFAD
    AVDRYKAYGATVIGVSADNIDTLAKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKILYEYTSLS
    PDKHVENTLAAVKAWADAHPKQ

    >gi|206559592|ref|YP_002230353.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia J2315]
    MKNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERDRLGGTCLNIGCIPSKALIHVADAFEQACGHAGEGALGIRVRAP
    EIDIAKSVAWKDGIVDRLTRGVGALLKKSGVRVLHGEARVIDGKTVEVVSAGHAVRIGCEHLLLATGSEPVELPSMPFGG
    HVVSSTDALSPATLPKRLVVVGAGYIGLELGIVYRKLGVDVSVVEAAERVLPAYDAELVRPVADSLARLGVRLWLGHKVL
    GLDKHGAVRVQAADGAEQTLPADRVLVAVGRRPRVDGFGLETLMLDRNGRALRIDDTCRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRQFMPAAIPAVCFTDPEIVTAGWSPDDAHAAGVDCLSASFPFAANGRAMTLQATDGFVRVVARR
    DNHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEALQEAALRALGHALHV

    >gi|206559764|ref|YP_002230528.1| OsmC-like protein [Burkholderia cenocepacia J2315]
    MSELSVEASIGSVDYLVHFTDGVHQWRADEPASLGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLAEVHVKLAHE
    SGSAGSTIVRRITLDGDLTDEQRERLLQIANACPVHKILTHPITIDTAIA

    >gi|206559883|ref|YP_002230647.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia J2315]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARH
    LPNIPVDNKIVSDNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGEVKTTANGVSIAYTDKDGNAQTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKTGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIAANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|206560129|ref|YP_002230893.1| OsmC-like protein [Burkholderia cenocepacia J2315]
    MSKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQT
    CPYSKATRGNIDVDIRIA

    >gi|206560263|ref|YP_002231027.1| thioredoxin [Burkholderia cenocepacia J2315]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|206560300|ref|YP_002231064.1| AhpC/TSA family protein [Burkholderia cenocepacia J2315]
    MSVEVDRQVPDFTAPATGGDISLSDLKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLLDADGVLRQAWRGIKVPGHVDDVLKAVQAL

    >gi|206560344|ref|YP_002231108.1| hypothetical protein BCAL1981 [Burkholderia cenocepacia J2315]
    MSFSRSAADAADTLPDLAATLGTPAEGAFVTLGDAFHTRLPAAPLAAPYVVGFSDEVAQLLDLPPTLAAQPGFAELFTGN
    PTRDWPANAMPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQLKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETAAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFHPACRDADDPY
    LALLEAATLRTADLVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFVDAFDANHICNHSDTGGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLALEREGDAELANKLLETMHASHADF
    TLTFRRLAQISKHDASRDAPVRDLFIDREAFDAWANLYRARLSEETRDDAARAVAMNRANPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQILRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|206560345|ref|YP_002231109.1| peptide methionine sulfoxide reductase [Burkholderia cenocepacia J2315]
    MSHDSDDKTFPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKIDYSHGMVRVEVRCNHCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPENE

    >gi|206560376|ref|YP_002231140.1| AhpC/TSA family protein [Burkholderia cenocepacia J2315]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|206560464|ref|YP_002231228.1| ArsC family protein [Burkholderia cenocepacia J2315]
    MAKPHTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLIEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    KTGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFTA

    >gi|206560468|ref|YP_002231232.1| glutathione peroxidase [Burkholderia cenocepacia J2315]
    MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDLYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDAAPGILGLKAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL

    >gi|206560558|ref|YP_002231323.1| HesB family protein [Burkholderia cenocepacia J2315]
    MAITLTEKAAQHVQKYLVRRGKGMGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFESHGVKVIVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|206560569|ref|YP_002231334.1| putative dihydrolipoamide dehydrogenase [Burkholderia cenocepacia J2315]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTVIAIVEASA
    GAAAPAPAKAPEAPKAAAAAPAPAAAPAPAPQAGSYSGAADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGG
    V
    CLNVGCIPSKALLHTSLVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPF
    HMEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVV
    EMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGAD
    KAGVAVTDRGFIEVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKT
    EDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGAIVGLNAGDLISEVCLAVEMGADAEDIGKTIH
    PHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|206560769|ref|YP_002231534.1| rhodanese superfamily protein [Burkholderia cenocepacia J2315]
    MTIVNLAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPFVDARTLKSWLDRGHDDTGRPVVMLDTRNAFEVDVGTFDNALDYRI
    DKFSEFPEVIDANRADLEGKTVVSF
    CTGGIRCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTENVTCFACRAVVTPEAQRSPSYVAGKSCPACAQAASAA

    >gi|206560879|ref|YP_002231644.1| DsbA-thioredoxin family protein [Burkholderia cenocepacia J2315]
    MSSKQTTLPGRVQALRKRAGRLPRLHWMVAGILVAGLLGWLLYRTPGAPAPRTGPEAAQAHPAGPPWRHGPADARFTLTL
    YADLE
    CPFCKAYYPTLMAWIDAHPDASLRWHHLPLAMHDPEASRLARMAECAGEAQGHEAFFGAIAWLYQNTRGDGQGLP
    ADLTWPGLTTAIQACLDSDRSAAIVRAQADEALRSGINATPTVRLEDSLTGGSLLLHGPIDGDALLSALDLVASDASRAP
    GPTHAADAALSGDTRTPAITTIR

    >gi|206560911|ref|YP_002231676.1| putative pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia J2315]
    MNHDVIVVGGSYSGMAATLQLVRARRSVLVIDAGQRRNRFASHSHGFLGQDGVPPGEIAANARRQLQAYPTLTWLEGRVE
    AVAGQADEFTVTTADGESHLGRRILLATGVTDQLPAIDGLAQRWGKTVFH
    CPYCHGYELGQGRIGIVGASPMSIHQAELL
    TDWGDVTLFVNGALELNEEIRSTLERRGVVIEEARIDKIEGHADVTLVDGRRLSFAGLFVATRTVPSDPLARTIGCALEE
    TPMGIQIRTDAESKTSVPGIFACGDVARAPHSVSLAVGNGAMTGAQIHRSLLWPETIEPAQAEGRAR

    >gi|206560922|ref|YP_002231687.1| carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MSRLPLPTIETAPAPSQPFLEKSQRANGFLPNLVRSLANAPVALETYLTVAEINSRAGLTFAEREAVQITAAAVHGCAFC
    VAGHTAAALKKAHVDHADVDALRDGEPVADPRLDAVAAFTRAVIATRGGVPDDALDAFLAAGFTEANALEVVLGVSLATL
    CNFANNLSRNELNPELAAYRWEPRTQAA

    >gi|206561111|ref|YP_002231876.1| putative methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia J2315]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESMKSIDPDSALAKRAVKQIERYFERASARFDLPLADVGSAFQHRVWDVIS
    DIPPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQQVKRWLLTHEGVPYR

    >gi|206561117|ref|YP_002231882.1| putative thioredoxin protein [Burkholderia cenocepacia J2315]
    MDTTLATFEKDVIEASLDTPVLVDFWAPWCGPCKTLGPLLEKLEADYAGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFVGVLPEGQLRAFLDRLLPAPEEAERRAAQYAMAEQRFDEALAHLEAALALNPGYDDARLDLIELLLARNEVD
    AARAETERLSPQTVQNGDPRYQAIKTRFDALEATADLPPTDALEARIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VTRDRTYGDDLGRRTMISVFELAGDRPDLVAGWRRKLSMALN

    >gi|206561122|ref|YP_002231887.1| putative peptide methionine sulfoxide reductase [Burkholderia cenocepacia J2315]
    MGNEMLETATLGGGCFWCTEAVFLDVDGVTAVQSGYAGGHTRNPGYRDICEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTTLNRQGNDVGTQYRSVVFTHSDAQRDTALDVIRELEREQVFGQPIVTQVVPLDGNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFAHRLKSLRGA

    >gi|206561203|ref|YP_002231968.1| hypothetical protein BCAL2868 [Burkholderia cenocepacia J2315]
    MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYIDIDTDAALVARYDEDVPVLLLDGAEVCRHRFDDARVRDALAARR

    >gi|206561332|ref|YP_002232097.1| disulfide bond formation protein B [Burkholderia cenocepacia J2315]
    MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFLAAGIRNWRGVWVLELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVAS
    LWRHRRKLAG

    >gi|206561380|ref|YP_002232145.1| thioredoxin reductase [Burkholderia cenocepacia J2315]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLITGIAQGGQLMTTTDVENWPADAKGVQGPELMARFQEHAERFNTEI
    VFDHIHTAKLHEKPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKQKEGVVDIKWDHVLDEVTGEESGVTGLRIKNVKTGATEDLQVQGVF
    VAIGHKPNTDLFQGQLEMKDGYILTKSGLQGNATSTSVPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRYLESLHDKK


    >gi|206561443|ref|YP_002232208.1| hypothetical protein BCAL3097 [Burkholderia cenocepacia J2315]
    MQILTPAMLAEWLGDTARPAPVVLDVREPWEIATAQIAGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|206561503|ref|YP_002232268.1| hypothetical protein BCAL3159 [Burkholderia cenocepacia J2315]
    MTTAPTPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSPAQVD
    QMLRQVTEAAASVGLRYDLPGTLVGDTLDGHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALTEFAVEAGLERSA
    VEAVLHSDAHRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADAFAQALDRAWRDGIVELGGSDAAACGPDGCELP
    RS

    >gi|206561536|ref|YP_002232301.1| putative oxidoreductase [Burkholderia cenocepacia J2315]
    MSLRLGDIAPDFEQESSLGTIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDGVESHKGW
    INDINETQSTVVGFPIIADADRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLTITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|206561560|ref|YP_002232325.1| carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|206561610|ref|YP_002232375.1| thioredoxin [Burkholderia cenocepacia J2315]
    MVPAGVDPAAFDAFDMQALDAGTFDAAIDGAGEALAVVFFWGVDCFNCEIAKKAMLAQPDAIRALRLKWFHCNVYEHREL
    GRRFGLHGVPTWFFFHRGKRLGRATGWHGLAQFQAAVAAARAKIAAAAGAPAGDGTDGPHDPLAGGD

    >gi|206561684|ref|YP_002232449.1| iron-sulfur cluster insertion protein ErpA [Burkholderia cenocepacia J2315]
    MNAVTETAATTTDMPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|206561688|ref|YP_002232453.1| putative OsmC-like protein [Burkholderia cenocepacia J2315]
    MPDRIRIRQRWSASMECKVSWMGQDGMAFSAETGSGHLVTMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKKSR
    QEVTGCSVTLKAERASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA

    >gi|206561755|ref|YP_002232520.1| putative thioredoxin protein [Burkholderia cenocepacia J2315]
    MMMKRMLALAVVAAAAVAGGVAAGHWFRGTADDGVAVAAPTAHGNPVEQLWASSLTGVDGKPATLTAFKGQKVVVNFWAS
    W
    CGPCVEEMPELVALSHQYKQKGIRFVGIGVDSEQNVKNFLQKVKVDYPVFVSGYAGADLARNFGNTAGALPFTVVIDET
    GKIRETKLGQIQPAELKKTLDAL

    >gi|206561759|ref|YP_002232524.1| ribosomal protein L11 methyltransferase [Burkholderia cenocepacia J2315]
    MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQHSRVVALLSADHEPAVLLAAA
    TNEIGLAETPQFVVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILAKKCGANPVIGIDIDPQAVESARQNSERNRAEVTYGLPDACPDGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|206561761|ref|YP_002232526.1| thiol peroxidase [Burkholderia cenocepacia J2315]
    MSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVI
    VVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYD
    AALAALK

    >gi|206561793|ref|YP_002232558.1| putative thioredoxin reductase [Burkholderia cenocepacia J2315]
    MIQVGDALPDAQLFEFIDDAREGCTLGPNACSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAA
    SVLATLTS

    >gi|206561824|ref|YP_002232589.1| carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIHASQINACANCLNMHTVEAREQGETEQRIYLLSAWREAPCY
    TDRERAALGWTDALTRLSEGHAAHEAAYAALNDHFSEEEQVKLTVMINVINGWNRLAVGFGLWVDPADAKAAAAKMVA

    >gi|206561871|ref|YP_002232634.1| ArsC family arsenate reductase [Burkholderia cenocepacia J2315]
    MITIYHNPRCSKSRETLALVESLNTAGAPLNVVEYLKTPPTVEELDTLHKQLGRPVRDMLRDGEEPYKALNLARADLTDA
    EAYGAIVAHPVLLQRPIVVYRGKAAIGRPPESVKALFE

    >gi|206562207|ref|YP_002232970.1| putative redoxin [Burkholderia cenocepacia J2315]
    MLSIGPFSIRVVAVAVAALLAWLVARVIQRRPPDGHHKSASSLILDVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDG
    GFDARIGIAAALVFVGWRLRRLPALRQPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPV
    VVNLWATW
    CAPCRREMPILEQAQRDHPGITVLMLNQGENAQAVRAFLEQQSLRFDHVLLDPSLHAMHTYGSRGLPTTLFF
    NAKGELVESHMGELTAARLKDTVTQCFRQ

    >gi|206562238|ref|YP_002233001.1| putative thioredoxin [Burkholderia cenocepacia J2315]
    MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITASFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVF
    LRDGVEVARVVRPADAKQIEADGFAALA

    >gi|206562342|ref|YP_002233105.1| putative methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia J2315]
    MTPAHLIPSPLGDIAVRIEDDALTGLYFVGQKYFPSLAIVREADALATSPIARQVAEEIAEYFTGARDTFSVPIHLRGTA
    FQRRVWQELLAIPFGELVSYGDITERVGLPMSGARAVGGAVGRNPVSIIVP
    CHRVVGASGSLTGYAGGIDRKRALLSLEG
    AELSRGVHHPMQHALAF

    >gi|206562399|ref|YP_002233162.1| hypothetical protein BCAM0539 [Burkholderia cenocepacia J2315]
    MTVELEERTAAQQALEDARAAAVAAGTPYAGGVAPEAAWALLSAGDALLVDVRTAEERKFVGYVPESLHVPWATGTSLTR
    NPRFVRELEAKTGKDAVVLLL
    CRSGNRSAQAAEAAAKAGFTQVFNVLEGFEGDLDERQHRGGQNGWRFRGLPWAQD

    >gi|206562459|ref|YP_002233222.1| putative reductase [Burkholderia cenocepacia J2315]
    MHSHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGRPRNRFAEHAHGFFGQDGKPPAQIVAEARAQLAAYPTVQRIDGE
    ARTAERDADGRFHVTLGDGSRASADRLILATGIRDALPALPGLAERWGISVLH
    CPYCHGYEVSGQRLGVLATHPLSVHQA
    ILIPDWGPTTWFTQGVVEANEEEAALLAARGVRIEHSPVVEILGAAPRIDALRLADGQVVPIDAMFIGARTDMASDLAQQ
    LGCAFDDGPLGTAIRVDTWKRTSVAGVYAAGDASSLMTNATFASASGVAAGVGAHRSLVFGLDA

    >gi|206562467|ref|YP_002233230.1| carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MTTAAHGFTSDTLGWRAWLDTVSLDTATPDQLAVLEASHPQAKTSDYYLLLVHLPDILRQRSGVFNAIMYGPGGLSRAER
    ELASTAVSRVNGCVY
    CASVHAQRFAQLAKRTDAIEQVFEDPATAGTTARERAIVRYAIALTERPDAIGEDDIAALEVEGL
    THEEILDLSHAIAIFAWANRLMLTLGEPVFPAPAATA

    >gi|206562545|ref|YP_002233308.1| mercuric reductase [Burkholderia cenocepacia J2315]
    MTQHFDAIVIGTGQAGPPLAARLAGAGMKVAIVERGRFGGTCVNTGCIPTKTLIASAYAAQLARRAGEYGVSVGGPVTVD
    MKAVKARKDQISGRSNHGVEQWVRGLDNTTVFQGHARFERPNAVRVGDDVLEAERIFINVGGRAQVPAMPGLDSVPYLTN
    STMMDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSRVTIIEKGSRLIRREDEDVSQAVREILEKEGIDVQLDANCLSARRD
    GDGIVVGLDCAGGGREVAGSHLLLAVGRVPNTDDLGLDRAGVDTDARGYITVDDQLRTNVPGIWALGDCNGRGAFTHTSY
    NDYEIVAANLLDDDPRKVSDRIMAYAMYIDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDAD
    SHAILGASILGVTGDEVVHGILDVMTAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|206562690|ref|YP_002233453.1| putative OsmC-like protein [Burkholderia cenocepacia J2315]
    MSLIHAAAVLDADAPDYVVQLQAGTHALTGDEAPREGGQDRGPAPYEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTE
    LHADREGVQYVRRVVTLDGPLDDAQRQRLAEICEKTPVTQFIKRGTRIETTLN

    >gi|206562751|ref|YP_002233514.1| putative organic hydroperoxide resistance protein [Burkholderia cenocepacia J2315]
    MNILYKTSATSTGGRDGRAVSADHKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKADAQALVDKAHHV
    CPYSNATRNNVPVRLAVV

    >gi|206562762|ref|YP_002233525.1| putative sulfurtransferase [Burkholderia cenocepacia J2315]
    MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAYAAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    LATLLASRGLKQGQQVVAYDAQGGAYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPAAGDFRAATPLEST
    VDAAAVLANVSSAARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGHELREAFATVLAGTEPNRV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPTP

    >gi|206563069|ref|YP_002233832.1| alkyl hydroperoxide reductase subunit F [Burkholderia cenocepacia J2315]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYAFETFFSLS
    CQNCPEVVQALNVMSLINPRIRHVAIDGALFQ
    DEVESRQIMAVPTMFLNGASFGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIVLATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAAPAATAQPRVEEAVAA

    >gi|206563070|ref|YP_002233833.1| alkyl hydroperoxide reductase subunit C [Burkholderia cenocepacia J2315]
    MPIINTQIKPFKATAYHNGDFVPVSEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIGKIKYPMIGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|206563129|ref|YP_002233892.1| hypothetical protein BCAM1277 [Burkholderia cenocepacia J2315]
    MQVDALHFTPWLSLAGGVLIGLAAAWLVALNGRIAGISGIVGGLLAAGGAERGWRVAFIAGMIVAPVAMHVAGSSLTPRI
    DAGWPELLAAGLLVGIGTRYAGG
    CTSGHGVCGMSRGALRSVVATATFMVAGFATVFVRLHVAGG

    >gi|206563247|ref|YP_002234010.1| putative sulfurtransferase [Burkholderia cenocepacia J2315]
    MTQSADSISRFPVASYQDVRARLLARDEIALIDVREEDPYAQGHPLWAANFPLSKLELDAWTRIPRRDTPIVVFGEAGGE
    DLAPRAAATLARLGYTDVRLLDGGLAGWVAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQALLDAKADVVIVDAR
    RFDEYQTMNIPTSTSVPGAELVLRVRALAPNPHTQVIVN
    CAGRTRSIIGTQSLVNAGLPNPVAALRNGTIGWTLAGQTLE
    RGAARRFPDEIDAAQRADARRAARAVAERAGVPRIALADVAALDEPGRTLYRFDVRTPEEYEAGHLPGFLSTPGGQLVQE
    TDHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFAERGQPPRDVPATPPATDVSPATLAGWLKEAAP
    GELAIVDVTASANYVKRHIPGAWFAVRAQLRDALAAIPPAKRYVFTCGSSLLARFAADDARALLPESADIRVLTGGTAAW
    IDAGLPLESGETRLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRDGTHHFNVI

    >gi|206563252|ref|YP_002234015.1| putative decarboxylase [Burkholderia cenocepacia J2315]
    MQPRLNFYAASPNAIKVMRNAEEFLAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETDRRLATVVTWRETPF
    FTERERAALEWTEALTLVASNHVPDAVWEAVKPHFTDEELFDLSMLIATINSWNRFAIAFRKMPE

    >gi|206563347|ref|YP_002234110.1| hypothetical protein BCAM1497 [Burkholderia cenocepacia J2315]
    MWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWVSMFAAAIGATMLADSLWFFMGRTRGRRLL
    NGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGIGVFLFWDLAGASLWAAFWLIGGAAIHD
    QIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSSEPPLIFDARPKAIREREPYRI
    AGAVPVDLDSPDLLDPEVLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMIHNIRALKGGLDAWEKHGYPVEPLPADLDSSRY
    FVRPEQGRLDGEYTVRATLSK

    >gi|206563988|ref|YP_002234751.1| hypothetical protein BCAM2151 [Burkholderia cenocepacia J2315]
    MSHVTDVPAADSPAALAHFEASLRFETDCWDVHDAFASGTSDFVLLDVRGPDQFAAGHVPGARNLPHRKIVESKLAGYPA
    DTLFVVY
    CAGPHCNGAARAAIRLARLGRPVKLMIGGVTGWLDEGFALSNDVQPTDVEAA

    >gi|206564017|ref|YP_002234780.1| putative peroxiredoxin OsmC family protein [Burkholderia cenocepacia J2315]
    MVTATRLGKPYCVEIGNGRSVVRSGTHKAGKGGDAGLRPHELLESALAACVCMSVELAAERAGVTLPACTVDVTLERRDV
    ETGFDIALRFVVPLSQAQHILVRDAVRASPVARTLGKPIRIGPAAIAHD

    >gi|206564138|ref|YP_002234901.1| putative methylamine utilization protein [Burkholderia cenocepacia J2315]
    MQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGAIAPTFELTDIRGAHVKVGGIDASGKAT
    LLFFLSPT
    CPVCKKLLPLLPSLQASEATPVNIVLASDGDADEHTRFARKHDLGRFPYVLSQELGLAYQIGKLPYAVLLDE
    TGTVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHSHDAHAQHA

    >gi|206564293|ref|YP_002235056.1| putative redoxin protein [Burkholderia cenocepacia J2315]
    MLPRFKTAALVIALAATAGLAAFAGTRDDAGVQAAPAGMAAPGFTGIDRWHNSAPLTLDQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDAKNVADAIRRFDIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIRGALAQAGDGTKGATRTP

    >gi|206564398|ref|YP_002235161.1| selenophosphate synthetase [Burkholderia cenocepacia J2315]
    MTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGLAAI
    GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPGAELAALPGVHALTDVTGFGLL
    GHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTGASGRNWAAYGTDIRLADGLPPVAQALLTDPQTSGGLLVACVP
    EAVDDVLACFRADGFDRAAVIGEMADGPARVDVA

    >gi|206564435|ref|YP_002235198.1| putative carboxymuconolactone dehydrogenase family protein [Burkholderia cenocepacia J2315]
    MTAPDNAPVSRFPVPALEDLPDDIRARIAAVQEKSGFVPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLSKAEREMIVVA
    TSAANQCQY
    CVIAHGAILRIRAKDPLIADQVATNYRKADLTARQKAMLDFAMKVSQAAHQVGEPDFDALKTHGFTEDDIW
    DIAAISAFFGMSNRLANVTNMRPNAEFYALGR

    >gi|206564506|ref|YP_002235269.1| metallo-beta-lactamase superfamily protein [Burkholderia cenocepacia J2315]
    MIFRQLFDPQSSTYTYLLADGASREALLIDPVFEQVRRDAALLDELGLRLVATVDTHVHADHVTGAWLLKQRTGSAIAIS
    AASGAQGADRYLNDGDRCAFGSRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLAVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDAQAAA
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFTGPLGHLPGATPIPLGELAARTGEIARDRPVVTV
    CRAGGRSA
    QATVILRKAGFDAVANLGGGMLRWRAEGRVVMDGRS

    >gi|206564521|ref|YP_002235284.1| putative cation-transporting ATPase membrane protein [Burkholderia cenocepacia J2315]
    MTEPLASAARQTIALSVDGMHCGGCTGRVQRALAAVPGVVDAAVDLDAQAATVTAQDTVEPERLVDAIREAGYHAAVREA
    AVEAGVATPAAREATSPAPAAAATIELDIDGMT
    CASCVSRVEKALAKVPGVTRASVNLATERATVDASAGVSAAQLADAV
    KQAGYGATPTASDTNAPAAAPTRPATPASIELDIDGMTCASCVSRVEKALAKVPGVTRASVNLATERATVDASADVSAAQ
    LAEAVKHAGYGATPAAVATPAAPATSAATSAAADVELDIGGMT
    CASCAGRVEKALAAVPGVARATVNLATERASVHGAGA
    LDAAALIAAVTTAGYHASLPAASPAGATAGADAQPAGPAPDADARKRREAIRERNLVIGAAVLSAPLVAPMLAAPFGLDL
    MLPGWLQLVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFEASAVIVTLVRF
    GKWLESRAKRQTTEAIRALNALRPDRARVVEHGVERDVPLSQVRVGTHVSIRPGERVPVDGRIVSGRSHIDESLITGESL
    PVPKDDGDAVTAGSINGEGALVVATTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLVGWLIA
    GAGMETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVTAFDA
    VGVPRDEALALAAAVQRQSDHPLARAVVAAHDADVAAQGGVAAPVVATDARAVAGRGVEAHVGGQQLALGSTRWRDELGI
    AVPPALDARAAELERAGNTISWLMRVDAPRAVLALIAFGDTVKPGARDAIAALSARGVASALVTGDNRGSAAAVAAALGI
    GEVHAQVLPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDISK
    RTYRKIQQNLFWAFVYNLVGVPLAALGLLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|206564556|ref|YP_002235319.1| putative lipoprotein [Burkholderia cenocepacia J2315]
    MKTVLRNLTAACLFAAAGAALAAAAPAGAPVANASPDGAHLPPGIAWQHGDVDAAFALAKREGKPLLLYWGAVWCPSCNQ
    VKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTAAHP
    VRQTLATALKNGASLTPDEWRLLADYSWDTDGALPVPADRVAQTLQSLAQRARAAGAKAEAARFALKSAVVAASDDPTQA
    GALDKAALADSLRTVLHDAALSRADSDVLVAAPARVVAYLGGDDAQRTKLRGAYDTALARLSTDTTLSSIDRLMALHGRV
    LLARGDARKGTPAAAPALADTARKQIAASVQGAANAYERQALVSEGADTLTDAGLYDESDALLKAELPRSSTPYYFMSGL
    AANAKARGDKAAALDWYRKAYDSANGPATKLRWGATYFANAVELAPNDAARIEGIAASVLAQADKTRDAFYGANLRALTK
    VVTQLNRWRASGAHDASVKSVVKQFDGVCGKLPAGDPQAAACAKLIQPVKA

    >gi|206564560|ref|YP_002235323.1| hypothetical protein BCAM2722 [Burkholderia cenocepacia J2315]
    MLRDLVAQYGPLLVFANVLAAAIGLPVPAMPTLVLFGAMSAMHPAMIGSQLVTVVALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLMAGLVFY
    RQIDWLFAGASRLGRAVLLVIVALLAVYAAVRWMRRRALIRQLANARIGVDELDVLLRDTAAPVVLDVRSPEHRKLDPFT
    IPGAQFADERQIGDIVARYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALALRGGLDAWRDTGRQLTSLVEETPAAN
    DAVAGWHKPA

    >gi|197294932|ref|YP_002153473.1| putative pyridine nucleotide-disulphide oxidoreductase family protein [Burkholderia cenocepacia J2315]
    MAEVKRVEYLFLGGGKGGKSLAMEMARQGKRVAVIERGMIGGSCINVACIPSKALIHRARATHAWRDAAQREDVTADMAG
    VSAYVASVVNGMVDVNRRAFEQSGLELVIGAGRFVAPRTVAVRGADGAETIYEGENVYINTGTVASIPDVPGLRDAQPLT
    HVEALRLTTLPGHLVVIGGGYIGLEMAQAFRRLGSAVTLVSDTPRVAMREDEDVSTVIQQALTDDGIRLELAARLVGVEG
    RSGERVTVRLADGRAIEGSHVLVATGRTPQAAGIGLELAGVETNERGFIKVDHRLATTAERTWAIGEVAGTPMFTHASFD
    DYRVLKAGIEGRPANTAERVIPYALFIDPELGRIGLNETDANARQIDVGVAKLPMASVPRARTDGNTRGFMKALVHPGTG
    AILGFTMVGTGAGDVTTVVQMAMLGGLPYTAVRDAIIGHPIVSEGLNLLFATLH

    >gi|197294937|ref|YP_002153478.1| organic hydroperoxide resistance protein [Burkholderia cenocepacia J2315]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRDIAQTLIDRAHVV
    CPYSNATRGNIDVTLTLV

    >gi|197295200|ref|YP_002153741.1| carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MSRLPLPTIETAPAPSQPFLEKSQRANGFLPNLVRSLANAPVALETYLTVAEINSRAGLTFAEREAVQITAAAVHGCAFC
    VAGHTAAALKKAHVDHAAVDALRDGEPVADPRLDAVAAFTRAVIATRGGVPDDALDAFLAAGFTEANALEVVLGVSLATL
    CNFANNLSRNELNPELAAYRWEPRTQAA

    >gi|197295281|ref|YP_002153822.1| OsmC family protein [Burkholderia cenocepacia J2315]
    MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGVREIRIRDFQVISDSPPDFAGYNLGPASPELQLGVL
    GS
    CLTHITLIQAAERGLKIDAIEVEVTGDQHPLAQQPGFEHVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNL
    LRLPQHIDGELRHTGA

    >gi|197295528|ref|YP_002154069.1| putative carboxymuconolactone decarboxylase family protein [Burkholderia cenocepacia J2315]
    MTRLTTLKPSEATGETAVVFDQIKTAIGKVPNAYATIGTHSPAGLAAMLHVDAAIAASSLEQADVEAVRLAVSALSGCDY
    CLAAHTMIGKMAGLAPDAMKHIRAGLPSGDTRRDALLAFVRSIVTSRDTVPAAVLDAVLAAGFSERQVIETILVITSITF
    TNLVNRVNDTTLDFPAVD

    >gi|197295538|ref|YP_002154079.1| putative pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia J2315]
    MESPRHYEYLFLGGGKGGKSLAMDLARSGKRVAVIERGMIGGSCINVACIPSKTLIQNARNMHAWRTAAAPARPVADMAR
    VHANVRGVVEGMVDINRRAFEQSGLELVIGSGRFVAPRRIAVRAADGSEQVFEGENVYINTGTVATIPDVPGLRDAGPLT
    HVEALDLDVLPEKLIVIGGGYVGLEMAQAFRRLGSEVVVVHDAPRVAAREDEDVSIAIQQAFESDGITLKLSARVARVDG
    RSGAGVTVALGDGTTVEGSHLLVATGRRPVTDGIGLELAGVERDERGFIKVDDTLATTAERTWAIGEVAGTPMFTHASFD
    DYRVLKAGIEGRRGSTASRVIPYALFTDPELARIGLNEAEAKARNTPVIVAKLPMAAVPRARTNGTTTGFMKALVAPDTG
    RILGFTMVGAGAGEVMSAVQIAMIGKLPYTSVRDAILAHPLLAEGLNLLFATIK

    >gi|197295554|ref|YP_002154095.1| peptide methionine sulfoxide reductase family protein [Burkholderia cenocepacia J2315]
    MPTRRHLLFAGATGLATLAALSSAGRRALVGRAFAAPPAGSPKAAPFEITLSDAEWHRRLTPAQYTVLREAGTERPYSSP
    LNAEHRPGTFACAGCDLALFSSATKFDSHTGWPSFWKPLDHAVGTDTDASFGMVRIEVHCRRCGGHLGHVFDDGPAPTGL
    RY
    CMNGVALVFHPAAA

    >gi|197295555|ref|YP_002154096.1| putative cytochrome c biogenesis protein [Burkholderia cenocepacia J2315]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAGMALTFTVVATLAAVGGGWVAQANQAGRWIAIVLLA
    VFGLTLLMPRFAEHLTRPLVAAGNRLTGFAQRDGRPAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQLSTVTTGGLETKLVDRLG
    GRSNGAPAATPATGAADNATGGAMMAAATDGPQAGGAAMVGSAMMRAAGATAAALPVEGTLPSLDGAVQWLNSPPLTAAG
    LRGKVVLIDFWTYS
    CINCLRTLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYAIWRA
    FNNEYWPAHYFIDAQGRIRHHHFGEGEYAQSERAIQSLLAEAGHPDALNVPLGLAGAPAKGALAAADSADVRSPETYVGY
    ARAESFASPGGVVRDAAHRYDAPGSPDLNGWGLAGTWNVGAERASLAAPDGRIIYRFHARDLHLVLGPGANGRPVRFRVT
    LDGAAPGAAHGADVDAQGYGTVTDQRLYQLVRQPGAIADRTFAIEFLDPGVDAYAFTFG

    >gi|197295556|ref|YP_002154097.1| methionine sulfoxide reductase A [Burkholderia cenocepacia J2315]
    MIPIPTRDAAAPRRAAMLRRIGAVAVAAAAVFGYQRIVNSAEPMRTVPAPTLDETPGASHDETAVLAGGCFWGVQGVFEH
    VKGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTQLNRQGPDEGSQYRSAIFP
    TTAQQRAVATAYIAQLGSAHVFPAPVVTRVEAYKGFYPAEAYHQNYLELHPDAPYIAFNDLPKVAGLKQRFPALYRADAV
    LWREARL

    >gi|206479970|ref|YP_002235481.1| thiol:disulfide interchange protein DsbC precursor [Burkholderia cenocepacia J2315]
    MNNRLSRGRVRLLVAALATTLTYTSIAYAADDTAAAQQVSDHLAATYPKTPFRDVKPAPLPGLYEVSMGETVAYTDSTGR
    YFLFGHLYDMQDQVDITEQRKAQGYKTRFPAAVLNHAIKTVHGNGQRVLAVFSDPD
    CPYCHQLEQQLAMVDNVTIYTFLY
    PLESLHPDAMTKSIRIQCSADPAKAWREWMTESRLPPLGSCHHPINDNIVLGSRLGVTGTPTIIAEDGRMLPGAVSAAQL
    SAWLDAGTSAASSNASAQPQGAFK