Burkholderia cenocepacia HI2424 uid58369

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116688044|ref|YP_833667.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIRASQINACANCLNMHTVEAREQGETEQRIYLLSAWREAPCY
    TDRERAALGWTEALTRLSEGHAAHEAAYAALNDHFSEEEQVKLTVMINVINGWNRLAVGFGLWVDPADAKAAAAKMVA

    >gi|116688148|ref|YP_833771.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia HI2424]
    MTDAKRPHDPRHRHAGGADACCADARDTQTATIADAAPAAGEHAHGHDHDHGHGHDHTAHGEAGHDHGHGHAGDDQHVHG
    ATCSHDHAAHDHAGHDHDHDHDHDHDHDHAAGDCCAPAALTLAPLPVAQATASGHVRSAFRIMQMD
    CPTEETLIRRKLGG
    MGEVSALEFNLMQRMLTVEHVPGAQPALESAIRSLGMTPEAASTDAPAAPTAPPPAKPWWPLALAGVAASASEGATWAGL
    PVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAI
    QGLMQLAPDTATVQQPDGAWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAGTI
    NESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLVAVVPPLVMGGAWHDWIYRALVL
    LVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLG
    ASLAARSDHPVSQAIAAAARAAGTAAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDALERQGK
    SVVVLVDATRVLGIFAVADTIKDTSRDAIADLHALGIRTAMLTGDNPHTALAIARQAGIDDARGNQLPEDKLAAVEELAA
    GGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKVVF
    LGLTVAGLGTMWMAVFADAGASLIVVANGLRLLSSSGAFGGAPAKR

    >gi|116688401|ref|YP_834024.1| protein-disulfide reductase [Burkholderia cenocepacia HI2424]
    MFNGMALSVRVRALRFLAVLLSFVFVLSGLSAARAADDFLDPSVAFKFSASESPGQVDVRFKIANGYYMYRERFAFAVKS
    GQATLGEPQFPAGHVKFDQTFQKNVETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAASS
    SGDTAAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFAVLLTAFAVSLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAAL
    WIVWPVLAGALKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATLLVGLAAGSTDPVKPLAVLAART
    VASGGAATAGAAAAQDGPAFASVRSSGELDALLKTSGQPVMLDFYADW
    CVSCKEMEHLTFTDARVQARLAKLHLVRADVT
    ANNPDDQALLKRFNLFGPPGIIFFDRNGNEISRVVGYQAADTFLRSLDRAAVPTV

    >gi|116688468|ref|YP_834091.1| glutathione S-transferase domain-containing protein [Burkholderia cenocepacia HI2424]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|116688532|ref|YP_834155.1| glutaredoxin-like protein [Burkholderia cenocepacia HI2424]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEF
    IGGSDIMMEMYQSGELQQLFAAA

    >gi|116688550|ref|YP_834173.1| protein-disulfide isomerase-like protein [Burkholderia cenocepacia HI2424]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGD
    LVDAKTHKNLTDARLSEINKIDFASLPFANAIKIVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STAKSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTTALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|116688589|ref|YP_834212.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MIQVGDALPDAQLFEFIDDAREGCTLGPNAYSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAA
    SVLATLTS

    >gi|116688624|ref|YP_834247.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVI
    VVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYD
    AALAALK

    >gi|116688626|ref|YP_834249.1| ribosomal protein L11 methyltransferase [Burkholderia cenocepacia HI2424]
    MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQHSRVVALLSADHEPAVLLAAA
    ANEIGLAETPKFVVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILAKKCGANPVIGIDIDPQAVESARQNSERNRAEVTYGLPDACPDGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|116688630|ref|YP_834253.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MMKRMLALAVVAAAAVAGGIAAGHWFRGTADDGVAVAAPAAHGNPVDQLWASSLTGVDGKPATLAAFKGQKVVVNFWASW
    CGPCVEEMPELVALSHQYKQKGIRFVGIGVDSEQNVKNFLQKVKVDYPVFISGYAGADLARNFGNTAGALPFTVVIDETG
    KIRETKLGQIQPAELKKTLDAL

    >gi|116688700|ref|YP_834323.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MECKVSWMGQDGMAFSAETGSGHLVTMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKKSRQEVSGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA

    >gi|116688704|ref|YP_834327.1| iron-sulfur cluster insertion protein ErpA [Burkholderia cenocepacia HI2424]
    MNAVTETAATTTDMPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|116688811|ref|YP_834434.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|116688835|ref|YP_834458.1| peroxidase [Burkholderia cenocepacia HI2424]
    MSLRLGDIAPDFEQESSLGTIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDGVESHKGW
    INDINETQSTVVGFPIIADADRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLTITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|116688869|ref|YP_834492.1| DSBA oxidoreductase [Burkholderia cenocepacia HI2424]
    MTTAPTPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSPAQVD
    QMLRQVTDAAASVGLHYDLPGTLVGDTLDGHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALTEFAVEAGLERAA
    VEAVLRSDAYRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADAFAQALDQAWRDGIVALDSSDAAACGPDGCELP
    ARS

    >gi|116688934|ref|YP_834557.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MQILTPAMLAEWLGDTARPAPVVLDVREPWEIATAQIAGSVAIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|116688997|ref|YP_834620.1| thioredoxin reductase [Burkholderia cenocepacia HI2424]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLITGIAQGGQLMTTTDVENWPADAKGVQGPELMARFQEHAERFNTEI
    VFDHIHTAKLHEQPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKQKEGVVDIKWDHVLDEVTGEESGVTGLRIKNVKTGATEDLLVQGVF
    VAIGHKPNTDLFQGQLEMKDGYILTKSGLQGNATSTSVPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRYLESLHDKK


    >gi|116689044|ref|YP_834667.1| disulfide bond formation protein B [Burkholderia cenocepacia HI2424]
    MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFLAAGIRNWRGVWVLELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVAS
    LWRHRRKLAS

    >gi|116689153|ref|YP_834776.1| glutaredoxin 2 [Burkholderia cenocepacia HI2424]
    MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYIDIDTDAALVARYDEDVPVLLLDGAEVCRHRFDDARVRDALASRR

    >gi|116689212|ref|YP_834835.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MKRKLLLGAMAALVAGHALLAQAELRPGAAAPDFTTQASLGGKTYTYSLADALKQGPVVLYFYPAAFTKGCTIEAHAFAD
    AVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSLS
    PDKHVENTLAAVKAWADAHPKQ

    >gi|116689268|ref|YP_834891.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia HI2424]
    MKNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERDRLGGTCLNIGCIPSKALIHVADAFEQACGHAGEAALGIRVRTP
    EIDIAKSVAWKDGIVDRLTRGVGALLKKNGVRVLHGEARVIDGKTVEVVSGGHTVRIGCEHLLLATGSEPVELPSMPFGG
    HVVSSTDALSPATLPKRLVVVGAGYIGLELGIVYRKLGVDVSVVEAAERVLPAYDAELVRPVADSLARLGVRLWLGHTVL
    GLDEHGAVRVRAADGAEQTLPADRVLVAVGRRPRVDGFGLETLMLDRNGRALRIDDACRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRQFTPAAIPAVCFTDPEIVTAGWSPDDAHAAGVDCLSASFPFAANGRAMTLQATDGFVRVVARR
    DNHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEALQEAALRALGHALHV

    >gi|116689412|ref|YP_835035.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MSELTVEASIGPVDYLVHFTDGVHQWRADEPASLGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLDEVHVKLAHE
    SGSAGSTIVRRISLDGDLTDEQRERLLQIANACPVHKILTHPITIDTAIA

    >gi|116689532|ref|YP_835155.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia HI2424]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGEAEVVTAKNVIIATGSKARH
    LPNIPVDNKIVSDNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTADGVSIVYTDKDGNAQTLDADRLIVSVGRLPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKTGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIAANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|116689724|ref|YP_835347.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MSKIDKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQT
    CPYSKATRGNIDVEIRIA

    >gi|116689849|ref|YP_835472.1| thioredoxin [Burkholderia cenocepacia HI2424]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|116689885|ref|YP_835508.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia HI2424]
    MSVEVDRQVPDFTAPATGGDVSLSDLKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLLDADGVLRQAWRGIKVPGHVDDVLKAVQAL

    >gi|116689929|ref|YP_835552.1| hypothetical protein Bcen2424_1908 [Burkholderia cenocepacia HI2424]
    MSFSRSAADAADTLPDLAATLGAPAERAFVTLGDAFHTRLPAAPLAAPYVVGFSDDVAQLLDLPPSIAAQPGFAELFAGN
    PTRDWPAHAMPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQLKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETAAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFYPACRDADDPY
    LALLEAATLRTADLVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLELEREGDAELANKLLETMHASHADF
    TLTFRRLAQISKHDASRDAPVRDLFIDREAFDAWANLYRARLSEETRDDAARAVAMNRANPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQILRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|116689930|ref|YP_835553.1| methionine-R-sulfoxide reductase [Burkholderia cenocepacia HI2424]
    MSHDSDDKTFPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKVDYSHGMVRVEVRCNNCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPENE

    >gi|116689961|ref|YP_835584.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia HI2424]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|116690052|ref|YP_835675.1| hypothetical protein Bcen2424_2031 [Burkholderia cenocepacia HI2424]
    MAKPHTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLIEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    KTGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFAA

    >gi|116690056|ref|YP_835679.1| glutathione peroxidase [Burkholderia cenocepacia HI2424]
    MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDQYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL

    >gi|116690145|ref|YP_835768.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia HI2424]
    MGRRGKDIMAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDDLAPEDQVFESHGVKVVVDPKSLAYI
    DGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV

    >gi|116690156|ref|YP_835779.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia HI2424]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTVIAIVEASA
    GAAAPAKEPEAPKPAAAAPAPAAAAPAPVPQAGSYSGAADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGGV
    CLNVGCIPSKALLHTSLVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPFH
    MEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVVE
    MMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGADK
    AGVAVTDRGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTE
    DQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGAIVGLNAGDLISEVCLAVEMGADAEDIGKTIHP
    HPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|116690335|ref|YP_835958.1| hypothetical protein Bcen2424_2314 [Burkholderia cenocepacia HI2424]
    MTIVNLAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPFVDARTLKAWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDNALDYRI
    DKFSEFPEVIDANRADLEGKTVVSF
    CTGGIRCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTENVTCFACRAVVTPEAQQSPSYVPGKSCPACPQAASAA

    >gi|116690580|ref|YP_836203.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia HI2424]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESMKSVDPDSALAKRAVKQIERYFERASARFDLPLADVGSAFQHRVWDAIS
    DIPPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQQVKRWLLTHEGVPY

    >gi|116690586|ref|YP_836209.1| thioredoxin [Burkholderia cenocepacia HI2424]
    MDTTLATFEKDVIEASLDTPVLVDFWAPWCGPCKTLGPLLEKLEADYAGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFVGVLPEGQLRAFLDRLLPAAEEAERRAAQYAMAEQRFDDALAHLEAALALNPGYDDARLDLIELLLARNEVD
    AARAETERLSPQTVQNGDPRYQAIKTRFDALDATADLPPTDALEARIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VTRDRAYGDDLGRRTMISVFELAGDRPDLVAAWRRKLSMALN

    >gi|116690591|ref|YP_836214.1| peptide methionine sulfoxide reductase [Burkholderia cenocepacia HI2424]
    MGNEMLETATLGGGCFWCTEAVFLDVDGVTAVQSGYAGGHTRNPGYRDICEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTTLNRQGNDVGTQYRSVVFTHSDAQRDTALDLIAELEREQVFGQPIVTQVVPLDGNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFSHRLKSLRGA

    >gi|116690856|ref|YP_836479.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia HI2424]
    MLPSRFGRRARQGWMLACAFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAALKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAPWVHDLKLLVD

    >gi|116690875|ref|YP_836498.1| glutaredoxin 3 [Burkholderia cenocepacia HI2424]
    MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLV
    PLLQAA

    >gi|116690876|ref|YP_836499.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MTFFTNYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAASDFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVEAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|116690879|ref|YP_836502.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia cenocepacia HI2424]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAASGVGTLTLVDADTVDLTNLQRQILHVTASVG
    RSKVESGRDALAQLNPEVTVNAVAERVDDAWLDAHVPHASVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDAAAPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGKTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCGGRH

    >gi|116690890|ref|YP_836513.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MNTTPPARRSTGPVRYIVAAAVVAAIAVAGFFAFNGKSSVPDATFTLLSGQKVSTGGDLKGKVYLVNFWATSCATCMQEM
    PQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKDGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|116690939|ref|YP_836562.1| DSBA oxidoreductase [Burkholderia cenocepacia HI2424]
    MKKLLSTLLLSLGLAAGLAQASPAAPAAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNID
    FKRVPVAFRDDFLPHSKLFYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKKFMDAYNSFSVQGEVN
    QSAKLLKDYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDFLVKQVQDKKL

    >gi|116691024|ref|YP_836647.1| glutathione-disulfide reductase [Burkholderia cenocepacia HI2424]
    MDFDYDLFVIGAGSGGVRLARMSASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHEVDDAKGFGWTFGAGTLDW
    PALIAAKDREINRLSDIYINLLRQSGVDMHTGRATLVDAHTVAIGERTIRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLAALPKRIAVVGGGYIAVEFAGIFNGFGSHVELFYRGEQILRGFDDDVRQFLTDEMTKQGVTIHARAVIESIERADDGT
    LFVQVGDARHGPYDQVLYATGRVPNVDGIGLEQAGILLDARGAIAVDAYSATSVPSIHAIGDVTSRPQLTPVATRDAGLL
    ARTLFGGSRVAVDHAYVPSAVFSQPEVATVGLTEADARRTLGDVDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTMRQKVAD

    >gi|116691147|ref|YP_836770.1| thioredoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MPALNLDTDADRIAERLADPGTLLVACLCAEWCGTCRDYRSAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDAHTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRDILNVEA

    >gi|116691170|ref|YP_836793.1| AraC family transcriptional regulator [Burkholderia cenocepacia HI2424]
    MKTAYPTDDARWGAVTERDPHADGAFFYAVSTTGVFCRPTCASRQPRRENVSFFADPAAARAAGFRPCKRCQPEGLPREL
    EIVNRACAVLDAHAERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQSGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYATASTSLGTVLVAATEQGICRIAFGDDAVSLVGELNDTFARAELVEASARLA
    PFVTQIRAYLDGTRQAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGAPRAVRAVASACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLAAEARHVHNDEAEAETEDSAV

    >gi|116691352|ref|YP_836885.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia HI2424]
    MSLIEVKVPDISDFNGIDVIEVNIKPGDVIEKEQTLLTLESDKASMEVPSHIAGTIKEIKVKAGDKVSQGTVIALVEASA
    NATAPAKAPEPAKPVAAAAPAAAPAQAAAAAAAAPAPQAGSYGGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLIER
    YSTLGGV
    CLNVGCIPSKALLHTALVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTSGLAGMARARKVEVVTGIG
    AFVDPFHMEVQGDNGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLG
    AEIDVVEMMDGLMMGADRDLVKVWEKFNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNG
    KKIGADKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEV
    AWAGKTEDQCKAEGIKYGEAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAED
    IGKTIHPHPTLGESVGMAAELYEGVCTDLPPPRKA

    >gi|116691370|ref|YP_836903.1| DSBA oxidoreductase [Burkholderia cenocepacia HI2424]
    MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGVTQHVDVVVTHKSYRLARGMVPTGFTDALYAKFGNATAAQRMMDAVCSAG
    AQEGLNYRFETMRFGDTSDAHLLVKSVQTSEDKQRMIEAIYRAATTDGIDIFDRAALIDLAKSIGISAASLSFDDREMVS
    EIARDEAEANRIANGVPLFVFNNRTYLSGAREVAVFEKALFDSAENVPDESEDTGGMSCSIDGCAH

    >gi|116691371|ref|YP_836904.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MENWTETIGAVTRRVHELARYTPDTLKGVGLLGAAGAKTNHLDAKTRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEE
    VAEALGVAINLNAGAAVVYSTHVLDALDHLGRE

    >gi|116691373|ref|YP_836906.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MTTHPNGIDVPALQQFAQEVATDPTKRNARFNVKTKWEHQTRSVATVSHYELGGVTHQRHFEIAADEPTQLLGTNSAPNP
    QELLMAALNA
    CLTVGYVVNAAAMGITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHQVVT
    KTSVNLANFSKAIRMVSTLEVREG

    >gi|116691430|ref|YP_836963.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MLSIGPFSIRVAAVAVAALLAWLVARVIQRRPPDGHHKSASSLILDVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDG
    GFDARIGIAAALVFAGWRLRRLPALRRPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPV
    VVNLWATW
    CAPCRREMPILEQAQRDHPGITVLMLNQGENAHAVRAFLEQQSLRFDHVLLDPSLHAMHAYGSRGLPTTLFF
    NAKGELVESHMGELTAARLKDAITQRFGQ

    >gi|116691465|ref|YP_836998.1| hypothetical protein Bcen2424_3366 [Burkholderia cenocepacia HI2424]
    MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITASFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVF
    LRDGVEVARVVRPADAKQIEADGFAALA

    >gi|116691548|ref|YP_837081.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia HI2424]
    MTPAHLIPSPLGDIAVRIEDDALTGLYFVGQKYFPSLAILNDAHTLATSPIARRVAEEIAEYFTGARDTFSVPIHLRGTA
    FQRRVWQELLAIPFGELVSYGDITERVGLPMSGARAVGGAVGRNPVSIIVP
    CHRVVGASGSLTGYAGGIERKRALLSLEG
    AELSRGAHHPMQQALAF

    >gi|116691612|ref|YP_837145.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MTVELEERTAAQQALEDARAAALAAGKPYAGGVAPETAWALFSAGDAVLVDVRTAEERKFVGYVPESLHVPWATGTSLTR
    NPRFVRELEAKTGKDAVVLLL
    CRSGNRSAQAAEAAAKGGFTQVFNVLEGFEGDLDERQHRGGQNGWRFRGLPWAQD

    >gi|116691670|ref|YP_837203.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia HI2424]
    MDTHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGRPRNRFAEHAHGFFGQDGKPPARIVAEASAQLAAYPTVQRIDGE
    ARTAERDAHGRFHVTLADGSRASADRLILATGIRDELPALPGLAERWGISVLH
    CPYCHGYEVSGQRLGVLATHPLSVHQA
    ILIPDWGPTTWFTQGVVEANDEEAALLAARGVRIERSPVVEILGDAPRIDALRLADGQAVPIDALFIGARTDMASDLAQQ
    LGCAFDEGPLGTAIRVDTWKQTSVAGVYAAGDASSLMTNATFASASGVAAGVGVHRSLIFGLDA

    >gi|116691678|ref|YP_837211.1| uncharacterized peroxidase-related enzyme [Burkholderia cenocepacia HI2424]
    MTTATHGFTSDTLGWRAWLDTVSLDAATPEQLAVLEASHPQAKTSDYYLLLVHLPEILRQRSGVFNAIMYGPGGLSRAER
    ELASTAVSRVNGCVY
    CASVHAQRFAQLAKRTDAIEQVFDDPATAGTTARERAIVRYAIALTERPDAINESDIAALEAEGL
    THEEILDLSHAIAIFAWANRLMLTLGEPVFPESAAGA

    >gi|116691746|ref|YP_837279.1| mercuric reductase [Burkholderia cenocepacia HI2424]
    MTQHFDAIVIGTGQAGPPLAARLAGASMKVAIIERGRFGGTCVNTGCIPTKTLIASAYAAQLARRASEYGVSVGGPVTVD
    MKAVKARKDQISGRSNHGVEQWVRGLDNTTVFQGHARFERANAVRVGDDVLEAERIFINVGGRAQVPAMPGLDSVPYLTN
    STMMDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSQVTIVEKGPRLIRREDEDVSQAVREILENEGIDVQLDANCLNARRD
    GDGIVVGLDCAGGGREVAGSHLLLAVGRVPNTDDLGLDRAGIATDARGYITVDEQLRTNVPGIWALGDCNGRGAFTHTAY
    NDYEIVAANLLDDDPRKVSDRIMAYAMYIDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDAD
    SHAILGASILGVTGDEVVHGMLDVMTAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|116691896|ref|YP_837429.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MSLIHAAAVLDADAPDYVVQLQAGTHTLTGDEAPREGGQDRGPAPYEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTE
    LHADREGVQYVRRVVTLDGPLDDAQRQRLTEICEKTPVTQFIKRGTRIETTLN

    >gi|116691961|ref|YP_837494.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKNDAQVLVDKAHHV
    CPYSNATRNNVPVRLTVV

    >gi|116691972|ref|YP_837505.1| 3-mercaptopyruvate sulfurtransferase [Burkholderia cenocepacia HI2424]
    MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAYAAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    LATLLASRGLKQGQQVVAYDAQGGAYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPVAGDFRSATPLEST
    VDAAAVLANVSSPARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGHELREAFATVLAGTEPNRV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPNP

    >gi|116692186|ref|YP_837719.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia HI2424]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYAFETFFSLS
    CQNCPEVVQALNVMSLINPRIRHVAIDGALFQ
    DEVESRQIMAVPTMFLNGASFGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIVLATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDVAAPAATAQPQAEEAVAA

    >gi|116692187|ref|YP_837720.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia HI2424]
    MPIINTQIKPFKATAYHNGEFVPVSEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIAKIKYPLVGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|116692355|ref|YP_837888.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MRARAGRATLDPFRFIHRLQRIQHRDIVTQSADSISRFPVASYEDVRARLLARDEIALIDVREEDPYAQGHPLWAANFPL
    SKLELDAWTRIPRRDTPIVVFGEAGGEDLAPRAAATLARLGYTDVRLLDGGLAGWVAAGGELFIDVNVPSKSFGEWVEAE
    RHTPSLSAQEVQALIDAKADVVIVDARRFDEYQTMNIPTSTSVPGAELVLRVRALAPDPRTQVIVN
    CAGRTRSIIGTQSL
    VNAGLPNPVAALRNGTIGWTLAGQTLERGAARRFPDEIDATQRAEARQAARAVAERAGVPRIALEDVATLDEPGRTLYRF
    DVRTPEEYEAGHLPGFLSTPGGQLVQETDHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFSERGQP
    PRDVPATPPAADVSPATLAGWLKEAAPGELAIVDVTASANYVKRHIPGAWFAVRAQLRDALATIPPAKRYVFTCGSSLLA
    RFAADDARALLPASAEIRVLTGGTAAWIEAGLPLESGETHLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRD
    GTHHFNVI

    >gi|116692360|ref|YP_837893.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MQPRLNFYAASPNAIKVMRNAEEFLAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETDRRLATVVTWRETPF
    FTERERAALEWTEALTLVASNHVPDAVWEAVKPHFTDEELFDLSMLIATINSWNRFAIAFRKMPE

    >gi|116692463|ref|YP_837996.1| uncharacterized membrane-associated protein [Burkholderia cenocepacia HI2424]
    MSSRSAAVWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWVSMFAAAIGATMLADSLWFFMGR
    TRGRRLLNGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGIGVFLFWDLAGASLWAAFWLI
    GGAAIHDQIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSDEPPLIFDARPKAIR
    DREPYRIAGAVPVDLDSPDLLDPEVLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMIHNIRALKGGLDAWEKHGYPVEPLPA
    DLDSSRYFVRPEQGGLEGEYTVRATLSK

    >gi|116693008|ref|YP_838541.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MSHVTDVPAADNAAALAHFEASLRFETDCWDVHDAFASGTPDFVLLDVRGPDQFAAGHVPGARNLPRRKIIESKLAGYPA
    DTLFVVY
    CAGPHCNGAARAAIQLARLGRPVKLMIGGVTGWLDEGFALSNDVQPVDAEAA

    >gi|116693154|ref|YP_838687.1| methylamine dehydrogenase accessory protein MauD [Burkholderia cenocepacia HI2424]
    MMQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGAIAPTFELTDMRGAQVKVGGIDAMGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQASEATPVNIVLASDGDADEHTRFARKHDLGRFPYVLSQELGFAYQIGKLPYAVLLD
    ETGTVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHSHDAHDGHAQHA

    >gi|116693277|ref|YP_838810.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia cenocepacia HI2424]
    MSDVKHYEYLFLGGGKGGKTLAMDMARQGRRVALIERGMIGGSCINVACIPSKTLIQNARQVHGWREAAGDASIMADMAN
    VSENVRGVVDGMIKINRAAFEKSGLDLITGTGRFIAPRTISVRTEDGSEAIYEGENVYINTGTVAQIPNVPGLRDAQPLT
    HVEALRLDELPEHIVVIGGGYIGLEMSQAFRRLGSAVTLIHDAPRVAMREDEDVSREIQQALEADGIKLELQSRIANVRG
    TSGQQVTIELADGRVVEGSHLLVTTGRKPQTDAIGLDLAGVEVDGRGIIKVDEKLATTAPRTWAIGEIAGTPMFTHASFD
    DYRVLKAGIEGRSVSTANRTIPYALFIDPELGRVGLNEADARAEGILVRVAKLPMAAVPRARTNGNTRGFMKALIHPETD
    RILGFTMVGAGAGDVTTAVQMAMLGGLSYRAVRDSIIAHPLLSEGLNLLFATLD

    >gi|116693297|ref|YP_838830.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MTARINTPAAAAATGATADVFATIRKAVGMVPNAYAAIGALNTPALQAILSADAVLSKGSLSAQDCETIKLVVSAISGCD
    Y
    CVAAHSLASKASGIAVDAVRAIRALEPTGDARRDALIRFIRVLQESRGTIASEELEAFRSAGYSDESVVDVALAIALIT
    FTNVFNRVNNTVVDFPALK

    >gi|116693349|ref|YP_838882.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MLPRLKTAALVIALAATAGLAAFAGTRDDAGVQASPAGMTAPAFTGIDRWHNSAPLTLDQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDAGNVADAIRRFDIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIRGALTQAGEGMKSATRTQ

    >gi|116693451|ref|YP_838984.1| selenophosphate synthetase [Burkholderia cenocepacia HI2424]
    MPTMTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFM
    PIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGL
    AAIGVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPGAELAALPGVHALTDVTGF
    GLLGHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTGASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVA
    CAPEAVDDVLACFRADGFDRAAVIGEMVDGPARVDVA

    >gi|116693495|ref|YP_839028.1| uncharacterized peroxidase-related enzyme [Burkholderia cenocepacia HI2424]
    MTASDNAPVSRFPVPALEDLPDDIRARIAAVQEKSGFIPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLSKAEREMIVVA
    TSAANQCQY
    CVIAHGAILRIRAKDPLIADQVATNYRKADITARQKAMLDFAMKVSQAAHQVGEPDFDTLKTHGFTEDDIW
    DIAAISAFFGMSNRIANVTNMRPNAAFYALGR

    >gi|116693565|ref|YP_839098.1| beta-lactamase domain-containing protein [Burkholderia cenocepacia HI2424]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALLDELGLRLVATVDTHVHADHVTGAWLLKQRTGSAIAIS
    AASGAHGADRYLNDGDRCAFGPRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDAQAAA
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFAGPLGHLPGATPIPLGELAARIGEIAHDRPVVTV
    CRAGGRSA
    QATVILKKAGFDAVANLGGGMLRWRAEGRVVMDGRS

    >gi|116693587|ref|YP_839120.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia HI2424]
    MTEPLASAALQTIELNVDGMHCGGCTGRVQRALAAVPGVVDAAVDLDAHTATVTAQETVEPDQLVDAVREAGYRAAVRDA
    AGEAVAPTQVAHATPDATPSAPAAATTIELDIDGMT
    CASCVSRVEKALVKVPGVTRASVNLATERATVDASAGVSATQLA
    DAVKQAGYGATPTASDTDVPARVPTLPTAPANIELDIDGMT
    CASCVSRVEKALAKVPGVTRASVNLATERATVDASNDVS
    AAQLADAVKQAGYGATPIAVSARPATSAATPASADVELDIGGMT
    CASCAGRVEKALAAVPGVARATVNLATERASVHGAG
    ALDAATLIAAVTTAGYRASLPAASPASAPAGADLQPASPAQDPDARKRREAIRERNLVIGAAVLSAPLVAPMLAAPFGID
    LMLPGWLQLVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFEASAVIVTLVR
    FGKWLESRAKRQTTEAIRALNALRPDRARVVEHGVERDVPLSQVRVGTRVGIRPGERVPVDGRIVSGRSHIDESLITGES
    LPVPKDDGDAVTAGSINGEGALVVETTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLVGWLI
    AGAGTETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVTAFD
    AVGIPRAEALALAAAVQRQSDHPLARAVVVAHDADVAAQGGAAASVVATDARAVAGRGVEAHVGGQQLALGSTRWRDELG
    IAVPPALDARAAELERAGNTISWLMRADAPRAVLALIAFGDTVKPGARDAIAALSARGVASALVTGDNRGSATAVAAALG
    IGEVHAQVLPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDIS
    KRTYRKIQQNLFWAFVYNLVGVPLAALGLLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|116693625|ref|YP_839158.1| thioredoxin domain-containing protein [Burkholderia cenocepacia HI2424]
    MKTVLRNLTAACLFVAASAALAAATPAGAPVASASPDGAHLPPGIAWQHGDVDAAFALAKREGKPLLLYWGAVWCPSCNQ
    VKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTAAHP
    VRQTLATALKSGASLTPDEWRLLADYSWDTDGALPVPADRVAQTLQSLAQRARAAGAKDESARFALKSAVVAASDDPTQA
    GALDKAALADSLRTVLHDAALSRADSDVLVAAPARVVAYLGGDDAQRTKLRGAYDTALARLSTDTTLSSIDRLMALHGRV
    LLARGDARKGAPLAAPALADTARKQIAASVQGAANAYERQALVSEGADTLTDAGLYDESDALLKAELPRSSTPYYFMSGL
    AANAKARGDKAAALDWYRKAYDAASGPATKLRWGATYFANAVELAPDDSARIEGIAASVLAQADKTRDAFYGANLRALTK
    VVTQLNRWRGSGAHDASVRSVVKQFDGVCGKLPAGDPQAAACTKLIQPVKA

    >gi|116693629|ref|YP_839162.1| rhodanese domain-containing protein [Burkholderia cenocepacia HI2424]
    MLRDLVAQYGPLLVFANVLAAAVGLPVPAMPTLVLFGAMSAMHPAMIGSQLVTVVALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLGAGLVFY
    RQIDWLFAGASRLGRAVLLVIVALLAVYAAVRWMRRRALIRQLANARIGVDELDVLLRDAAAPVVLDVRSPEHRKLDPFT
    IPGAQFADERQIGDIVARYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALALRGGLDAWRDTGRQLTSLVEEMPAAN
    DPVAGWHKPA

    >gi|116693785|ref|YP_839318.1| arsenate reductase [Burkholderia cenocepacia HI2424]
    MMITIYHNPRCSKSRETLALVESLNTAGVPLNVVEYLKTPPTVEDLETLHRQLGRPVRDMLRDGEEPYQTLNLARADLTD
    AEAYAAIVAHPILLQRPIVVYRGKAAIGRPPESVKALFE

    >gi|116686514|ref|YP_839761.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRDIAQTLIDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|116686621|ref|YP_839868.1| methionine sulfoxide reductase A [Burkholderia cenocepacia HI2424]
    MIPIPTRDAAARRRAVMLRRIGAIAVAAAAVFGYQRIVNSAEPMRTVPAATLDETPGASHDETAVLAGGCFWGVQGVFEH
    VKGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTQLNRQGPDEGSQYRSAIFP
    TTAQQRAVATAYIAQLGSAHVFPAPVVTRVEAYKGFYPAEAYHQNYLELHPDAPYIAFNDLPKVAGLKQYFPALYRTDPV
    LWREARS

    >gi|116686622|ref|YP_839869.1| cytochrome c biogenesis protein, transmembrane region [Burkholderia cenocepacia HI2424]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAGMALTFAVVATLAAVGGGWVAQANQAGRWIAIVLLA
    VFGLTLLMPRFAEHLTRPLVAAGNRLTGFAQRDGRAAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQLSTVTTGGLETKLVDRLG
    GRSNGAPAATAAPGATDNAAGGAMMAAAADGAQAGEGAMAGSAMMRAVGATPSALPVEGTLPSLDGAVQWLNSPPLTAAG
    LRGKVVLVDFWTYS
    CINCLRTLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYSIWRA
    FNNEYWPAHYFIDAQGRVRHHHFGEGEYVQSERAIQSLLAEAGHPDALNVPLGLAGAPAKGALAAADSADVRSPETYVGY
    ARAESFASPGGVVRDAAHRYDAPAQPDLNGWGLAGTWSVGAERAALAAPDGRIVYRFHARDLHLVLGPGANGRPVRFRVT
    LDGTAPGAAHGADVDAQGYGTVTGQRLYQLVRQPGAIADRTFAIEFLDPGVDAYAFTFG

    >gi|116686623|ref|YP_839870.1| methionine-R-sulfoxide reductase [Burkholderia cenocepacia HI2424]
    MPTRRHLLFAGATGLAALAALSSAGRRALVGRAFAAPPAGSSKAAPFEITLSDAEWHRRLTPAQYTVLREAGTERPFTSP
    LNDEHRHGTFACAGCDLALFSSATKFDSHTGWPSFWKPLDHAVGTDTDASFGMVRTEVHCRRCGGHLGHVFDDGPAPTGL
    RY
    CMNGLALAFHPAVA

    >gi|116686953|ref|YP_840200.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGVREIRIRDFQVISDSPPDFAGYNLGPASPELQLGVL
    GS
    CLTHITLIQAAERGLKIDAIEVEVTGDQHPLAQQPGFEHVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNL
    LRLPQHIDGELRHTSA

    >gi|116687119|ref|YP_840366.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MSGGSSASTMISLPFSENPVSRLPLPTIETAPAASQPFLEKSQRANGFLPNLVRSLANAPVALETYLTVAEINGRAGLTF
    AEREAVQITAAAVHGCAF
    CVAGHTAAALKKAQVERADVDALRDGEPVAEPRLEAVAAFTRAVIATRGAVTDDALDAFLAV
    GFTEANALEVVLGVSLATLCNFANNLARNELNPELAAYRWEPRTQAA

    >gi|116687175|ref|YP_840421.1| protein-disulfide isomerase [Burkholderia cenocepacia HI2424]
    MPSTVPARVAGPGSEVGVTASVGPAATSKVNPADPNLDPGVAALKAALHARYPATQFREVAATPSAGIYEVVMGNKVAYT
    DVTGRYFLFGHLFDMVTQQDLTVPLEQALQKVRFPADRLQDAFVEVHGSGRRKLAIFDDPD
    CPYCLALEDDLSKLKDVTI
    YRFMYPLESIHPRARAHSIAIWCAEDRLATWHAWMPLALSRWMRDQGSTPTGGAAKTPAPTRVEPKLVSCANPIEANEAL
    AASMGISGTPALVSEDGRVLPGAASAEAIDQWLGAK

    >gi|116687230|ref|YP_840476.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MSNKLNGIDVAALQEFAQGVAETTDAVKRSARFNVKTKWEHQTRSVATVSRYSLLGVEYPRHFEIAADEPIEFLGQNSAP
    NPQELLMAALNA
    CLSVGYAVNAAAMGIQLLSLEIETEGELDLRGVLGLDDTVNPGYDQVSYVVRLHTDAPREKVEELHKI
    VTKTSANLANFSRAIRMVPKLEILEA

    >gi|116687236|ref|YP_840482.1| DsbA oxidoreductase [Burkholderia cenocepacia HI2424]
    MTLRNGNMKKVSVEVWSDFACPWCWIAKRRFEKAAHELQGQIEVVVTPKSYRLAKGMAPVAIREVIHRKFGNAAAAEQM

    >gi|116687238|ref|YP_840484.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MERKWTDKLAALIKRVGAFSKANAPVASAFHKLEKATRESDVLDAKTHELISLAVAVTTRCDGCIAAHAGAAKKAGASKE
    EIAAALGTAIALNAGAAYVYSARAFEAYEEL

    >gi|116687284|ref|YP_840530.1| DSBA oxidoreductase [Burkholderia cenocepacia HI2424]
    MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGVTQHVDVVVTHKSYRLARGMVPTGFTDALYAKFGNPTAAQRMMDAVCSAG
    AQEGLNYRFETMRFGDTSDAHLLVKSVQTSEDKQRMIEAIYRAATTDGIDIFDRAALIDLAKSIGISAASLSFDDREMVS
    EIARDEAEANRIANGVPLFVFNNRTYLSGAREVAVFEKALFDSAENVPDESEDTGGMSCSIDGCAH

    >gi|116687285|ref|YP_840531.1| alkylhydroperoxidase [Burkholderia cenocepacia HI2424]
    MENWTETIGAVTRRVHELARYTPDTLKGVGLLGAAGAKTNHLDAKTRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEE
    VAEALGVAINLNAGAAVVYSTHVLDALDHLGRE

    >gi|116687287|ref|YP_840533.1| OsmC family protein [Burkholderia cenocepacia HI2424]
    MTTHPNGIDVPALQQFAQEVATDPTKRNARFNVKTKWEHQTRSVATVSHYELGGVTHQRHFEIAADEPTQLLGMNSAPNP
    QELLMAALNA
    CLTVGYVVNAAAMGITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHRVVT
    KTSVNLANFSKAIRMVSTLEVREG

    >gi|116688774|ref|YP_834397.1| hypothetical protein Bcen2424_0751 [Burkholderia cenocepacia HI2424]
    MVPAGVDPAAFDTFDMQALDAGTFDATIDGAGDALAVVFFWGVDCFNCEIAKKAMLAQPDAIRALGLKWFHCNVYEHHEL
    GRRFGLHGVPTWFFFHRGKRLGRATGWHGLAQFQAAVAAARGKIAAAADAPADERTGGPHDPLAGGD

    >gi|116689178|ref|YP_834801.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia HI2424]
    MSSARPAPHRRLSRLIRTAAALAAAVALTACTHDEPRWNLTNVTGHLPDLSFKLTGGDGHPVDADAFRGRVALVYFGYTH
    CPDVCPETLARLMEVLAKLGPRADDVRILFVSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQMEK
    RDPSGGYEVTHSSAVYIFDATGRARLLATDRDSPDAIAADVRRIIDTASTT