Burkholderia cenocepacia AU 1054 uid58371

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|107021612|ref|YP_619939.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIRASQINACANCLNMHTVEAREQGETEQRIYLLSAWREAPCY
    TDRERAALGWTEALTRLSEGHAAHEAAYAALNDHFSEEEQVKLTVMINVINGWNRLAVGFGLWVDPADAKAAAAKMVA

    >gi|107021644|ref|YP_619971.1| redoxin [Burkholderia cenocepacia AU 1054]
    MIQVGDALPDAQLFEFIDDAREGCTLGPNAYSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVEAPGKFEVSDAA
    SVLATLTS

    >gi|107021678|ref|YP_620005.1| redoxin [Burkholderia cenocepacia AU 1054]
    MSKVTLGGNPIDLAGTFPAVGAQAADFKLVGKDLADLSLASFAGKRKVLNIAPSLDTPTCATSTRKFNEAASSLDNTVVI
    VVSADLPFAATRFCTTEGLANVVTASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAELVGEIKDEPNYD
    AALAALK

    >gi|107021680|ref|YP_620007.1| ribosomal protein L11 methyltransferase [Burkholderia cenocepacia AU 1054]
    MSYRELVVELAREHAEALSDALLDLGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQHSRVVALLSADHEPAVLLAAA
    ANEIGLAETPKFVVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILAKKCGANPVIGIDIDPQAVESARQNSERNRAEVTYGLPDACPDGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|107021684|ref|YP_620011.1| redoxin [Burkholderia cenocepacia AU 1054]
    MMKRMLALAVVAAAAVAGGIAAGHWFRGTADDGVAVAAPAAHGNPVDQLWASSLTGVDGKPATLAAFKGQKVVVNFWASW
    CGPCVEEMPELVALSHQYKQKGIRFVGIGVDSEQNVKNFLQKVKVDYPVFISGYAGADLARNFGNTAGALPFTVVIDETG
    KIRETKLGQIQPAELKKTLDAL

    >gi|107021754|ref|YP_620081.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MECKVSWMGQDGMAFSAETGSGHLVTMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKKSRQEVSGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA

    >gi|107021758|ref|YP_620085.1| iron-sulfur cluster insertion protein ErpA [Burkholderia cenocepacia AU 1054]
    MNAVTETAATTTDMPLPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|107021863|ref|YP_620190.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|107021887|ref|YP_620214.1| peroxidase [Burkholderia cenocepacia AU 1054]
    MSLRLGDIAPDFEQESSLGTIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDGVESHKGW
    INDINETQSTVVGFPIIADADRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLTITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|107021921|ref|YP_620248.1| DSBA oxidoreductase [Burkholderia cenocepacia AU 1054]
    MTTAPTPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSPAQVD
    QMLRQVTDAAASVGLHYDLPGTLVGDTLDGHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALTEFAVEAGLERAA
    VEAVLRSDAYRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADAFAQALDQAWRDGIVALDSSDAAACGPDGCELP
    ARS

    >gi|107021990|ref|YP_620317.1| rhodanese-like protein [Burkholderia cenocepacia AU 1054]
    MQILTPAMLAEWLGDTARPAPVVLDVREPWEIATAQIAGSVAIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|107022053|ref|YP_620380.1| thioredoxin reductase [Burkholderia cenocepacia AU 1054]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLITGIAQGGQLMTTTDVENWPADAKGVQGPELMARFQEHAERFNTEI
    VFDHIHTAKLHEQPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKQKEGVVDIKWDHVLDEVTGEESGVTGLRIKNVKTGATEDLLVQGVF
    VAIGHKPNTDLFQGQLEMKDGYILTKSGLQGNATSTSVPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRYLESLHDKK


    >gi|107022099|ref|YP_620426.1| disulfide bond formation protein B [Burkholderia cenocepacia AU 1054]
    MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFLAAGIRNWRGVWVLELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVAS
    LWRHRRKLAS

    >gi|107022207|ref|YP_620534.1| glutaredoxin 2 [Burkholderia cenocepacia AU 1054]
    MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYIDIDTDAALVARYDEDVPVLLLDGAEVCRHRFDDARVRDALASRR

    >gi|107022267|ref|YP_620594.1| redoxin [Burkholderia cenocepacia AU 1054]
    MKRKLLLGAMAALVAGHALLAQAELRPGAAAPDFTTQASLGGKTYTYSLADALKQGPVVLYFYPAAFTKGCTIEAHAFAD
    AVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSLS
    PDKHVENTLAAVKAWADAHPKQ

    >gi|107022321|ref|YP_620648.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia AU 1054]
    MKNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERDRLGGTCLNIGCIPSKALIHVADAFEQACGHAGEAALGIRVRTP
    EIDIAKSVAWKDGIVDRLTRGVGALLKKNGVRVLHGEARVIDGKTVEVVSGGHTVRIGCEHLLLATGSEPVELPSMPFGG
    HVVSSTDALSPATLPKRLVVVGAGYIGLELGIVYRKLGVDVSVVEAAERVLPAYDAELVRPVADSLARLGVRLWLGHTVL
    GLDEHGAVRVRAADGAEQTLPADRVLVAVGRRPRVDGFGLETLMLDRNGRALRIDDACRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRQFTPAAIPAVCFTDPEIVTAGWSPDDAHAAGVDCLSASFPFAANGRAMTLQATDGFVRVVARR
    DNHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEALQEAALRALGHALHV

    >gi|107022463|ref|YP_620790.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MSELTVEASIGPVDYLVHFTDGVHQWRADEPASLGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLDEVHVKLAHE
    SGSAGSTIVRRISLDGDLTDEQRERLLQIANACPVHKILTHPITIDTAIA

    >gi|107022583|ref|YP_620910.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia AU 1054]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGEAEVVTAKNVIIATGSKARH
    LPNIPVDNKIVSDNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGADVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTADGVSIVYTDKDGNAQTLDADRLIVSVGRLPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKTGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIAANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|107022776|ref|YP_621103.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MSKIDKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DAEVDLGTAGNAYFLQARLNVSVPGLERDVAQRIVDAAHQT
    CPYSKATRGNIDVEIRIA

    >gi|107022807|ref|YP_621134.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MTTLNDYLAQKRDAWHAKQQAARNDPDFKATPLKATVRALGRSGVREIRIRDFQVISDSPPDFAGYNLGPASPELQLGVL
    GS
    CLTHITLIQAAERGLKIDAIEVEVTGDQHPLAQQPGFEHVPVFPHNLRYTLDIVSPEPPEAIRALHQAVEEVCPIFNL
    LRLPQHIDGELRHTSA

    >gi|107023137|ref|YP_621464.1| protein-methionine-S-oxide reductase [Burkholderia cenocepacia AU 1054]
    MPTRRHLLFAGATGLAALAALSSAGRRALVGRAFAAPPAGSSKAAPFEITLSDAEWHRRLTPAQYTVLREAGTERPFTSP
    LNDEHRHGTFACAGCDLALFSSATKFDSHTGWPSFWKPLDHAVGTDTDASFGMVRTEVHCRRCGGHLGHVFDDGPAPTGL
    RY
    CMNGLALAFHPAVA

    >gi|107023138|ref|YP_621465.1| cytochrome c biogenesis protein, transmembrane region [Burkholderia cenocepacia AU 1054]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLAGMALTFAVVATLAAVGGGWVAQANQAGRWIAIVLLA
    VFGLTLLMPRFAEHLTRPLVAAGNRLTGFAQRDGRAAGPASSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTLL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQLSTVTTGGLETKLVDRLG
    GRSNGAPAATAAPGATDNAAGGAMMAAAADGAQAGEGAMAGSAMMRAVGATPSALPVEGTLPSLDGAVQWLNSPPLTAAG
    LRGKVVLVDFWTYS
    CINCLRTLPYTTAWARKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYSIWRA
    FNNEYWPAHYFIDAQGRVRHHHFGEGEYVQSERAIQSLLAEAGHPDALNVPLGLAGAPAKGALAAADSADVRSPETYVGY
    ARAESFASPGGVVRDAAHRYDAPAQPDLNGWGLAGTWSVGAERAALAAPDGRIVYRFHARDLHLVLGPGANGRPVRFRVT
    LDGTAPGAAHGADVDAQGYGTVTGQRLYQLVRQPGAIADRTFAIEFLDPGVDAYAFTFG

    >gi|107023139|ref|YP_621466.1| methionine sulfoxide reductase A [Burkholderia cenocepacia AU 1054]
    MIPIPTRDAAARRRAVMLRRIGAIAVAAAAVFGYQRIVNSAEPMRTVPAATLDETPGASHDETAVLAGGCFWGVQGVFEH
    VKGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVYDPTQITYGRLLQVFFSVAHDPTQLNRQGPDEGSQYRSAIFP
    TTAQQRAVATAYIAQLGSAHVFPAPVVTRVEAYKGFYPAEAYHQNYLELHPDAPYIAFNDLPKVAGLKQYFPALYRTDPV
    LWREARS

    >gi|107023252|ref|YP_621579.1| hypothetical protein Bcen_1702 [Burkholderia cenocepacia AU 1054]
    MHAATRRAVGRSARYRCPRRLRDNTVFRINAPASHPFLRAAVRPFSRRTIMTIVNLAAYHFVSLDANEQWRPLVTARCNE
    LGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLFEGKFATLQFKESLSDSQPFRRMLVRLKREIITMKKPAIKPEL
    GRAPFVDARTLKAWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDNALDYRIDKFSEFPEVIDANRADLEGKTVVSF
    CTGGI
    RCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALNPQLQPTENVTCFACRAVVTPEAQQSPSYVP
    GKSCPACPQAASAA

    >gi|107023498|ref|YP_621825.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia AU 1054]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESMKSVDPDSALAKRAVKQIERYFERASARFDLPLADVGSAFQHRVWDAIS
    DIPPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQQVKRWLLTHEGVPY

    >gi|107023504|ref|YP_621831.1| thioredoxin [Burkholderia cenocepacia AU 1054]
    MDTTLATFEKDVIEASLDTPVLVDFWAPWCGPCKTLGPLLEKLEADYAGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFVGVLPEGQLRAFLDRLLPAAEEAERRAAQYAMAEQRFDDALAHLEAALALNPGYDDARLDLIELLLARNEVD
    AARAETERLSPQTVQNGDPRYQAIKTRFDALDATADLPPTDALEAHIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VTRDRAYGDDLGRRTMISVFELAGDRPDLVAAWRRKLSMALN

    >gi|107023509|ref|YP_621836.1| peptide methionine sulfoxide reductase [Burkholderia cenocepacia AU 1054]
    MGNEMLETATLGGGCFWCTEAVFLDVDGVTAVQSGYAGGHTRNPGYRDICEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTTLNRQGNDVGTQYRSVVFTHSDAQRDTALDLIAELEREQVFGQPIVTQVVPLDGNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFSHRLKSLRGA

    >gi|107023770|ref|YP_622097.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia AU 1054]
    MLPSRFGRRARQGWMLACAFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAALKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAPWVHDLKLLVD

    >gi|107023788|ref|YP_622115.1| glutaredoxin GrxC [Burkholderia cenocepacia AU 1054]
    MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLV
    PLLQAA

    >gi|107023789|ref|YP_622116.1| rhodanese-like protein [Burkholderia cenocepacia AU 1054]
    MTFFTNYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAASDFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVEAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|107023792|ref|YP_622119.1| UBA/THIF-type NAD/FAD binding fold [Burkholderia cenocepacia AU 1054]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHAIVVGAGGLGSPAAMYLAASGVGTLTLVDADTVDLTNLQRQILHVTASVG
    RSKVESGRDALAQLNPEVTVNAVAERVDDAWLDAHVPHASVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDAAAPCYACVFPEDQPFEEVA
    CSTMGVFAPTVGIIGAMQAAEALRVIGGIGKTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCGGRH

    >gi|107023803|ref|YP_622130.1| redoxin [Burkholderia cenocepacia AU 1054]
    MNTTPPARRSTGPVRYIVAAAVVAAIAVAGFFAFNGKSSVPDATFTLLSGQKVSTGGDLKGKVYLVNFWATSCATCMQEM
    PQMVDTYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKDGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|107023854|ref|YP_622181.1| DSBA oxidoreductase [Burkholderia cenocepacia AU 1054]
    MKKLLSTLLLSLGLAAGLAQASPAAPAAGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNID
    FKRVPVAFRDDFLPHSKLFYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKKFMDAYNSFSVQGEAN
    QSAKLLKDYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDFLVKQVQDKKL

    >gi|107023937|ref|YP_622264.1| glutathione reductase [Burkholderia cenocepacia AU 1054]
    MDFDYDLFVIGAGSGGVRLARMSASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHEVDDAKGFGWTFGAGTLDW
    PALIAAKDREINRLSDIYINLLRQSGVDMHTGRATLVDAHTVAIGERTIRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLAALPKRIAVVGGGYIAVEFAGIFNGFGSHVELFYRGEQILRGFDDDVRQFLTDEMTKQGVTIHARAVIESIERADDGT
    LFVQVGDARHGPYDQVLYATGRVPNVDGIGLEQAGILLDARGAIAVDAYSATSVPSIHAIGDVTSRPQLTPVATRDAGLL
    ARTLFGGSRVAVDHAYVPSAVFSQPEVATVGLTEADARRTLGDVDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTMRQKVAD

    >gi|107024060|ref|YP_622387.1| thioredoxin domain-containing protein [Burkholderia cenocepacia AU 1054]
    MPALNLDTDADRIAERLADPGTLLVACLCAEWCGTCRDYRSAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDAHTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRDILNVEA

    >gi|107024084|ref|YP_622411.1| AraC family transcriptional regulator [Burkholderia cenocepacia AU 1054]
    MKTAYPTDDARWGAVTERDPHADGAFFYAVSTTGVFCRPTCASRQPRRENVSFFADPAAARAAGFRPCKRCQPEGLPREL
    EIVNRACAVLDAHAERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQSGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYATASTSLGTVLVAATEQGICRIAFGDDAVSLVGELNDTFARAELVEASARLA
    PFVTQIRAYLDGTRQAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGAPRAVRAVASACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLAAEARHVHNDEAEAETEDSAV

    >gi|107024124|ref|YP_622451.1| protein-disulfide isomerase-like [Burkholderia cenocepacia AU 1054]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGD
    LVDAKTHKNLTDARLSEINKIDFASLPFANAIKIVKGNGARKIAVFSDPN
    CPYCKKLETTLQSVDNVTVYTFLYPVLSPD
    STAKSKAIWCATDRAKTWESWMLDHRAPSGAGTCDTTALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|107024142|ref|YP_622469.1| glutaredoxin-like protein [Burkholderia cenocepacia AU 1054]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKAFSNWPTIPQLYVKGEF
    IGGSDIMMEMYQSGELQQLFAAA

    >gi|107024207|ref|YP_622534.1| glutathione S-transferase-like [Burkholderia cenocepacia AU 1054]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|107024274|ref|YP_622601.1| protein-disulfide reductase [Burkholderia cenocepacia AU 1054]
    MFNGMALSVRVRALRFLAVLLSFVFVLSGLSAARAADDFLDPSVAFKFSASESPGQVDVRFKIANGYYMYRERFAFAVKS
    GQATLGEPQFPAGHVKFDQTFQKNVETYRDEVVVHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVMKVDGAALGAASS
    SGDTAAAGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFAVLLTAFAVSLISGKDIALPERWQNGAAEASSARQGGHFVAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGVGAGTVLPRAGAWMDGVKVFFGIVLLAAAL
    WIVWPVLAGALKMVLAALWLLIAAAALGLFTPNAGAASIWRRLGRGVGAALAIWAATLLVGLAAGSTDPVKPLAVLAART
    VASGGAATAGAAAAQDGPAFASVRSSGELDALLKTSGQPVMLDFYADW
    CVSCKEMEHLTFTDARVQARLAKLHLVRADVT
    ANNPDDQALLKRFNLFGPPGIIFFDRNGNEISRVVGYQAADTFLRSLDRAAVPTV

    >gi|107024443|ref|YP_622770.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia cenocepacia AU 1054]
    MIEQPAIDKNLPLDIRGTAFQQRVWQVLRKIPVGSTLSYAQVARLVGTDVSELDIASACAGNPLAVAIPCHRVVRTDGRF
    WGYAWGIDRKQALLDRERCTHVQS

    >gi|107024473|ref|YP_622800.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia AU 1054]
    MTDAKRPHDPRHRHAGGADACCADARDTQTATIADAAPAAGEHAHGHDHDHGHGHDHTAHGEAGHDHGHGHAGDDQHVHG
    ATCSHDHAAHDHAGHDHDHDHDHDHDHDHAAGDCCAPAALTLAPLPVAQATASGHVRSAFRIMQMD
    CPTEETLIRRKLGG
    MGEVSALEFNLMQRMLTVEHVPGAQPALESAIRSLGMTPEAASTDAPAAPTAPPPAKPWWPLALAGVAASASEGATWAGL
    PVWLSAALALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEAKSLDRARNAI
    QGLMQLAPDTATVQQPDGAWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVEKASGDAVYAGTI
    NESGSFDYRVTAVAANSTLARIIHAVEEAQGAKAPTQRFVDQFARVYTPIVFAVALLVAVVPPLVMGGAWHDWIYRALVL
    LVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDVHADDADAARVRHLG
    ASLAARSDHPVSQAIAAAARAAGTAAFADVQDFEAIVGRGVRGTIDGTRYWLGNHRLVEELERCSTALEAKLDALERQGK
    SVVVLVDATRVLGIFAVADTIKDTSRDAIADLHALGIRTAMLTGDNPHTALAIARQAGIDDARGNQLPEDKLAAVEELAA
    GGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNIGFALGVKVVF
    LGLTVAGLGTMWMAVFADAGASLIVVANGLRLLSSSGAFGGAPAKR

    >gi|107025366|ref|YP_622877.1| selenophosphate synthetase [Burkholderia cenocepacia AU 1054]
    MPTMTEATQAQPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFM
    PIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGESVCADAGIPVAGGHSIDSVEPIYGL
    AAIGVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDADGYAQMVATTTKLNRPGAELAALPGVHALTDVTGF
    GLLGHTLELARGAQLTARVHYASLPWLAGVETFVADGVFTGASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVA
    CAPEAVDDVLACFRADGFDRAAVIGEMVDGPARVDVA

    >gi|107025469|ref|YP_622980.1| redoxin [Burkholderia cenocepacia AU 1054]
    MLPRLKTAALVIALAATAGLAAFAGTRDDAGVQASPAGMTAPAFTGIDRWHNSAPLTLDQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDAGNVADAIRRFDIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIRGALTQAGEGMKSATRTQ

    >gi|107025522|ref|YP_623033.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MTARINTPAAAAATGATADVFATIRKAVGMVPNAYAAIGALNTPALQAILSADAVLSKGSLSAQDCETIKLVVSAISGCD
    Y
    CVAAHSLASKASGIAVDAVRAIRALEPTGDARRDALIRFIRVLQESRGTIASEELEAFRSAGYSDESVVDVALAIALIT
    FTNVFNRVNNTVVDFPALK

    >gi|107025541|ref|YP_623052.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Burkholderia cenocepacia AU 1054]
    MDMARQGRRVALIERGMIGGSCINVACIPSKTLIQNARQVHGWREAAGDASIMADMANVSENVRGVVDGMIKINRAAFEK
    SGLDLITGTGRFIAPRTISVRTEDGSEAIYEGENVYINTGTVAQIPNVPGLRDAQPLTHVEALRLDELPEHIVVIGGGYI
    GLEMSQAFRRLGSAVTLIHDAPRVAMREDEDVSREIQQALEADGIKLELQSRIANVRGTSGQQVTIELADGRVVEGSHLL
    VTTGRKPQTDAIGLDLAGVEVDGRGIIKVDEKLATTAPRTWAIGEIAGTPMFTHASFDDYRVLKAGIEGRSVSTANRTIP
    YALFIDPELGRVGLNEADARAEGILVRVAKLPMAAVPRARTNGNTRGFMKALIHPETDRILGFTMVGAGAGDVTTAVQMA
    MLGGLSYRAVRDSIIAHPLLSEGLNLLFATLD

    >gi|107025664|ref|YP_623175.1| methylamine dehydrogenase accessory protein MauD [Burkholderia cenocepacia AU 1054]
    MMQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGAIAPTFELTDMRGAQVKVGGIDAMGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQASEATPVNIVLASDGDADEHTRFARKHDLGRFPYVLSQELGFAYQIGKLPYAVLLD
    ETGTVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHSHDAHDGHAQHA

    >gi|107025808|ref|YP_623319.1| rhodanese-like protein [Burkholderia cenocepacia AU 1054]
    MSHVTDVPAADNAAALAHFEASLRFETDCWDVHDAFASGTPDFVLLDVRGPDQFAAGHVPGARNLPRRKIIESKLAGYPA
    DTLFVVY
    CAGPHCNGAARAAIQLARLGRPVKLMIGGVTGWLDEGFALSNDVQPVDAEAA

    >gi|107026349|ref|YP_623860.1| uncharacterized membrane-associated protein [Burkholderia cenocepacia AU 1054]
    MSSRSAAVWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWVSMFAAAIGATMLADSLWFFMGR
    TRGRRLLNGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGIGVFLFWDLAGASLWAAFWLI
    GGAAIHDQIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSDEPPLIFDARPKAIR
    DREPYRIAGAVPVDLDSPDLLDPEVLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMIHNIRALKGGLDAWEKHGYPVEPLPA
    DLDSSRYFVRPEQGGLEGEYTVRATLSK

    >gi|107026452|ref|YP_623963.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MQPRLNFYAASPNAIKVMRNAEEFLAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETDRRLATVVTWRETPF
    FTERERAALEWTEALTLVASNHVPDAVWEAVKPHFTDEELFDLSMLIATINSWNRFAIAFRKMPE

    >gi|107026457|ref|YP_623968.1| rhodanese-like protein [Burkholderia cenocepacia AU 1054]
    MRARAGRATLDPFRFIHRLQRIQHRDIVTQSADSISRFPVASYEDVRARLLARDEIALIDVREEDPYAQGHPLWAANFPL
    SKLELDAWTRIPRRDTPIVVFGEAGGEDLAPRAAATLARLGYTDVRLLDGGLAGWVAAGGELFIDVNVPSKSFGEWVEAE
    RHTPSLSAQEVQALIDAKADVVIVDARRFDEYQTMNIPTSTSVPGAELVLRVRALAPDPRTQVIVN
    CAGRTRSIIGTQSL
    VNAGLPNPVAALRNGTIGWTLAGQTLERGAARRFPDEIDATQRAEARQAARAVAERAGVPRIALEDVATLDEPGRTLYRF
    DVRTPEEYEAGHLPGFLSTPGGQLVQETDHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFSERGQP
    PRDVPATPPAADVSPATLAGWLKEAAPGELAIVDVTASANYVKRHIPGAWFAVRAQLRDALATIPPAKRYVFTCGSSLLA
    RFAADDARALLPASAEIRVLTGGTAAWIEAGLPLESGETHLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRD
    GTHHFNVI

    >gi|107026623|ref|YP_624134.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia AU 1054]
    MPIINTQIKPFKATAYHNGEFVPVSEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIAKIKYPLVGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|107026624|ref|YP_624135.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia cenocepacia AU 1054]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYAFETFFSLS
    CQNCPEVVQALNVMSLINPRIRHVAIDGALFQ
    DEVESRQIMAVPTMFLNGASFGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIVLATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDVAAPAATAQPQAEEAVAA

    >gi|107026834|ref|YP_624345.1| 3-mercaptopyruvate sulfurtransferase [Burkholderia cenocepacia AU 1054]
    MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAYAAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    LATLLASRGLKQGQQVVAYDAQGGAYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPVAGDFRSATPLEST
    VDAAAVLANVSSPARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGHELREAFATVLAGTEPNRV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPNP

    >gi|107026844|ref|YP_624355.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKNDAQVLVDKAHHV
    CPYSNATRNNVPVRLTVV

    >gi|107026907|ref|YP_624418.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MSLIHAAAVLDADAPDYVVQLQAGTHTLTGDEAPREGGQDRGPAPYEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTE
    LHADREGVQYVRRVVTLDGPLDDAQRQRLTEICEKTPVTQFIKRGTRIETTLN

    >gi|107027057|ref|YP_624568.1| mercuric reductase [Burkholderia cenocepacia AU 1054]
    MTQHFDAIVIGTGQAGPPLAARLAGASMKVAIIERGRFGGTCVNTGCIPTKTLIASAYAAQLARRASEYGVSVGGPVTVD
    MKAVKARKDQISGRSNHGVEQWVRGLDNTTVFQGHARFERANAVRVGDDVLEAERIFINVGGRAQVPAMPGLDSVPYLTN
    STMMDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSQVTIVEKGPRLIRREDEDVSQAVREILENEGIDVQLDANCLNARRD
    GDGIVVGLDCAGGGREVAGSHLLLAVGRVPNTDDLGLDRAGIATDARGYITVDEQLRTNVPGIWALGDCNGRGAFTHTAY
    NDYEIVAANLLDDDPRKVSDRIMAYAMYIDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDAD
    SHAILGASILGVTGDEVVHGMLDVMTAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|107027110|ref|YP_624621.1| glutathione S-transferase-like [Burkholderia cenocepacia AU 1054]
    MDNPRRNHMKLYHAPGSCSQAICIVLREGDIDAEIVKVDARKHVVDGGRDYYDVNELGYVPLLELDDGTILREGPVIAQY
    LADQRPEAALAPAYGTLARYRLMEWLNFLGTEIHKGFIPLLYAVQAGRYVEPVRQKLDSRFAWIDRQLDGRTFLTGDTFT
    VADAYLFALTGWGKADWMRSVYNADIDLSRHAHLRAWYERVRERPAVQAALAADNLLR

    >gi|107027143|ref|YP_624654.1| hypothetical protein Bcen_4802 [Burkholderia cenocepacia AU 1054]
    MDTEQRYTANAPTRAEVDALGGATVIEFGANWCGICAGAQPAITASFSAHPAVRHLKIEDGPGRPLGRSFGVKLWPTLVF
    LRDGVEVARVVRPADAKQIEADGFAALA

    >gi|107027178|ref|YP_624689.1| redoxin [Burkholderia cenocepacia AU 1054]
    MLSIGPFSIRVAAVAVAALLAWLVARVIQRRPPDGHHKSASSLILDVLLLGLIAARVGYVAQWWPDYAASPRAIVALGDG
    GFDARIGIAAALVFAGWRLRRLPALRRPVLAGIVAGLGAWGIAQGTLATLQRGAPPLAAMPLQALDSTPVLPAGFVGKPV
    VVNLWATW
    CAPCRREMPILEQAQRDHPGITVLMLNQGENAHAVRAFLEQQSLRFDHVLLDPSLHAMHAYGSRGLPTTLFF
    NAKGELVESHMGELTAARLKDAITQRFGQ

    >gi|107027233|ref|YP_624744.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MTTHPNGIDVPALQQFAQEVATDPTKRNARFNVKTKWEHQTRSVATVSHYELGGVTHQRHFEIAADEPTQLLGTNSAPNP
    QELLMAALNA
    CLTVGYVVNAAAMGITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHQVVT
    KTSVNLANFSKAIRMVSTLEVREG

    >gi|107027235|ref|YP_624746.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MENWTETIGAVTRRVHELARYTPDTLKGVGLLGAAGAKTNHLDAKTRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEE
    VAEALGVAINLNAGAAVVYSTHVLDALDHLGRE

    >gi|107027236|ref|YP_624747.1| DSBA oxidoreductase [Burkholderia cenocepacia AU 1054]
    MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGVTQHVDVVVTHKSYRLARGMVPTGFTDALYAKFGNATAAQRMMDAVCSAG
    AQEGLNYRFETMRFGDTSDAHLLVKSVQTSEDKQRMIEAIYRAATTDGIDIFDRAALIDLAKSIGISAASLSFDDREMVS
    EIARDEAEANRIANGVPLFVFNNRTYLSGAREVAVFEKALFDSAENVPDESEDTGGMSCSIDGCAH

    >gi|107027254|ref|YP_624765.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia AU 1054]
    MSLIEVKVPDISDFNGIDVIEVNIKPGDVIEKEQTLLTLESDKASMEVPSHIAGTIKEIKVKAGDKVSQGTVIALVEASA
    NATAPAKAPEPAKPVAAAAPAAAPAQAAAAAAAAPAPQAGSYGGSADIECDMLVLGAGPGGYSAAFRAADLGMKTVLIER
    YSTLGGV
    CLNVGCIPSKALLHTALVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTSGLAGMARARKVEVVTGIG
    AFVDPFHMEVQGDNGKKIVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLG
    AEIDVVEMMDGLMMGADRDLVKVWEKFNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNG
    KKIGADKAGVAVTERGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEV
    AWAGKTEDQCKAEGIKYGEAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAED
    IGKTIHPHPTLGESVGMAAELYEGVCTDLPPPRKA

    >gi|107027503|ref|YP_625014.1| arsenate reductase [Burkholderia cenocepacia AU 1054]
    MMITIYHNPRCSKSRETLALVESLNTAGVPLNVVEYLKTPPTVEDLETLHRQLGRPVRDMLRDGEEPYQTLNLARADLTD
    AEAYAAIVAHPILLQRPIVVYRGKAAIGRPPESVKALFE

    >gi|107027660|ref|YP_625171.1| rhodanese-like protein [Burkholderia cenocepacia AU 1054]
    MLRDLVAQYGPLLVFANVLAAAVGLPVPAMPTLVLFGAMSAMHPAMIGSQLVTVVALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLGAGLVFY
    RQIDWLFAGASRLGRAVLLVIVALLAVYAAVRWMRRRALIRQLANARIGVDELDVLLRDAAAPVVLDVRSPEHRKLDPFT
    IPGAQFADERQIGDIVARYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALALRGGLDAWRDTGRQLTSLVEEMPAAN
    DPVAGWHKPA

    >gi|107027665|ref|YP_625176.1| thioredoxin domain-containing protein [Burkholderia cenocepacia AU 1054]
    MRGAACRPASSSSLHGPRCVPGIALKPSFSTEPASMKTVLRNLTAACLFVAASAALAAATPAGAPVASASPDGAHLPPGI
    AWQHGDVDAAFALAKREGKPLLLYWGAVW
    CPSCNQVKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTM
    ILFRPDGTEVTRLPGEADLDRYMQALSLGMTAAHPVRQTLATALKSGASLTPDEWRLLADYSWDTDGALPVPADRVAQTL
    QSLAQRARAAGAKDESARFALKSAVVAASDDPTQAGALDKAALADSLRTVLHDAALSRADSDVLVAAPARVVAYLGGDDA
    QRTKLRGAYDTALARLSTDTTLSSIDRLMALHGRVLLARGDARKGAPLAAPALADTARKQIAASVQGAANAYERQALVSE
    GADTLTDAGLYDESDALLKAELPRSSTPYYFMSGLAANAKARGDKAAALDWYRKAYDAASGPATKLRWGATYFANAVELA
    PDDSARIEGIAASVLAQADKTRDAFYGANLRALTKVVTQLNRWRGSGAHDASVRSVVKQFDGVCGKLPAGDPQAAACTKL
    IQPVKA

    >gi|107027701|ref|YP_625212.1| heavy metal translocating P-type ATPase [Burkholderia cenocepacia AU 1054]
    MTEPLASAALQTIELNVDGMHCGGCTGRVQRALAAVPGVVDAAVDLDAHTATVTAQETVEPDQLVDAVREAGYRAAVRDA
    AGEAVAPTQVAHATPDATPSAPAAATTIELDIDGMT
    CASCVSRVEKALVKVPGVTRASVNLATERATVDASAGVSATQLA
    DAVKQAGYGATPTASDTDVPARVPTLPTAPANIELDIDGMT
    CASCVSRVEKALAKVPGVTRASVNLATERATVDASNDVS
    AAQLADAVKQAGYGATPIAVSARPATSAATPASADVELDIGGMT
    CASCAGRVEKALAAVPGVARATVNLATERASVHGAG
    ALDAATLIAAVTTAGYRASLPAASPASAPAGADLQPASPAQDPDARKRREAIRERNLVIGAAVLSAPLVAPMLAAPFGID
    LMLPGWLQLVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAYGLSLWMLLRDPAHPGHLYFEASAVIVTLVR
    FGKWLESRAKRQTTEAIRALNALRPDRARVVEHGVERDVPLSQVRVGTRVGIRPGERVPVDGRIVSGRSHIDESLITGES
    LPVPKDDGDAVTAGSINGEGALVVETTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLVGWLI
    AGAGTETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVTAFD
    AVGIPRAEALALAAAVQRQSDHPLARAVVVAHDADVAAQGGAAASVVATDARAVAGRGVEAHVGGQQLALGSTRWRDELG
    IAVPPALDARAAELERAGNTISWLMRADAPRAVLALIAFGDTVKPGARDAIAALSARGVASALVTGDNRGSATAVAAALG
    IGEVHAQVLPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDIS
    KRTYRKIQQNLFWAFVYNLVGVPLAALGLLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|107027724|ref|YP_625235.1| beta-lactamase-like [Burkholderia cenocepacia AU 1054]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALLDELGLRLVATVDTHVHADHVTGAWLLKQRTGSAIAIS
    AASGAHGADRYLNDGDRCAFGPRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDAQAAA
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFAGPLGHLPGATPIPLGELAARIGEIAHDRPVVTV
    CRAGGRSA
    QATVILKKAGFDAVANLGGGMLRWRAEGRVVMDGRS

    >gi|107027795|ref|YP_625306.1| hypothetical protein Bcen_5460 [Burkholderia cenocepacia AU 1054]
    MTASDNAPVSRFPVPALEDLPDDIRARIAAVQEKSGFIPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLSKAEREMIVVA
    TSAANQCQY
    CVIAHGAILRIRAKDPLIADQVATNYRKADITARQKAMLDFAMKVSQAAHQVGEPDFDTLKTHGFTEDDIW
    DIAAISAFFGMSNRIANVTNMRPNAAFYALGR

    >gi|107028516|ref|YP_625611.1| OsmC-like protein [Burkholderia cenocepacia AU 1054]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRDIAQTLIDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|107028685|ref|YP_625780.1| dihydrolipoamide dehydrogenase [Burkholderia cenocepacia AU 1054]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTVIAIVEASA
    GAAAPAKEPEAPKPAAAAPAPAAAAPAPVPQAGSYSGAADIECDMLVLGAGPGGYSAAFRAADLGMKTVLVERYSTLGGV
    CLNVGCIPSKALLHTSLVVEEAAALASHGITFGKPQVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPFH
    MEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYSTLGAEIDVVE
    MMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGADK
    AGVAVTDRGFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTE
    DQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGAIVGLNAGDLISEVCLAVEMGADAEDIGKTIHP
    HPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|107028696|ref|YP_625791.1| iron-sulfur cluster assembly protein IscA [Burkholderia cenocepacia AU 1054]
    MAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDDLAPEDQVFESHGVKVVVDPKSLAYIDGTELDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|107028785|ref|YP_625880.1| glutathione peroxidase [Burkholderia cenocepacia AU 1054]
    MSTLYSFSAETLAGAPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDQYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLIDREGRIVKRYAPSTKPDEIAADIDKLL

    >gi|107028789|ref|YP_625884.1| hypothetical protein Bcen_6046 [Burkholderia cenocepacia AU 1054]
    MAKPHTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLIEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    KTGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFAA

    >gi|107028881|ref|YP_625976.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia AU 1054]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|107028912|ref|YP_626007.1| protein-methionine-S-oxide reductase [Burkholderia cenocepacia AU 1054]
    MSHDSDDKTFPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKVDYSHGMVRVEVRCNNCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPENE

    >gi|107028913|ref|YP_626008.1| hypothetical protein Bcen_6171 [Burkholderia cenocepacia AU 1054]
    MSFSRSAADAADTLPDLAATLGAPAERAFVTLGDAFHTRLPAAPLAAPYVVGFSDDVAQLLDLPPSIAAQPGFAELFAGN
    PTRDWPAHAMPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQLKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETAAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFYPACRDADDPY
    LALLEAATLRTADLVAQWQAVGFCHGVMNTDNMSILGVTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLELEREGDAELANKLLETMHASHADF
    TLTFRRLAQISKHDASRDAPVRDLFIDREAFDAWANLYRARLSEETRDDAARAVAMNRANPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQILRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|107028957|ref|YP_626052.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia cenocepacia AU 1054]
    MSVEVDRQVPDFTAPATGGDVSLSDLKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLLDADGVLRQAWRGIKVPGHVDDVLKAVQAL

    >gi|107028993|ref|YP_626088.1| thioredoxin [Burkholderia cenocepacia AU 1054]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|107029247|ref|YP_626342.1| alkylhydroperoxidase AhpD core [Burkholderia cenocepacia AU 1054]
    MSRLPLPTIETAPAASQPFLEKSQRANGFLPNLVRSLANAPVALETYLTVAEINGRAGLTFAEREAVQITAAAVHGCAFC
    VAGHTAAALKKAQVERADVDALRDGEPVAEPRLEAVAAFTRAVIATRGAVTDDALDAFLAVGFTEANALEVVLGVSLATL
    CNFANNLARNELNPELAAYRWEPRTQAA

    >gi|107021827|ref|YP_620154.1| hypothetical protein Bcen_0267 [Burkholderia cenocepacia AU 1054]
    MVPAGVDPAAFDTFDMQALDAGTFDATIDGAGDALAVVFFWGVDCFNCEIAKKAMLAQPDAIRALGLKWFHCNVYEHHEL
    GRRFGLHGVPTWFFFHRGKRLGRATGWHGLAQFQAAVAAARGKIAAAADAPADERTGGPHDPLAGGD

    >gi|107022233|ref|YP_620560.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia AU 1054]
    MSSARPAPHRRLSRLIRTAAALAAAVALTACTHDEPRWNLTNVTGHLPDLSFKLTGGDGHPVDADAFRGRVALVYFGYTH
    CPDVCPETLARLMEVLAKLGPRADDVRILFVSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQMEK
    RDPSGGYEVTHSSAVYIFDATGRARLLATDRDSPDAIAADVRRIIDTASTT