Burkholderia ambifaria MC40 6 uid58701

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|172059087|ref|YP_001806739.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MTAKLNPFAAAPALMKSWMTVSVDAAGSLEPTLIELVKIRASQINACANCLNMHTVEAREQGETEQRINLLAAWREAPCY
    TDRERAALRWTDALTRLSEGHGAHEAAYAALNDHFSQEEQVKLTLMINVINGWNRLAVGFGLWVDPAEAKAAAAKMVA

    >gi|172059190|ref|YP_001806842.1| heavy metal translocating P-type ATPase [Burkholderia ambifaria MC40-6]
    MTDAQRPHDPRHRHAGGAATCSADARDTQAATVADAGPAAGEHAHGDAAARGAQPDGCGHNHDHDHASAHGTGHDHGDHA
    HGDGHAHGAACSHDHAGHDHAGHDHDHDHDHDHDHDHDHAAGACCAPAALTLAPLPVARATASGHVRSAFRIMQMD
    CPTE
    ETLIRKKLGGMQQVSALEFNLMQRMLTVEHVPGAQPAIESAIRTLGMTPEAAAADVPATPVAPPPAKPWWPLALAGVAAI
    ASEAVSWAGLPMWLSAVLALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLFTIAELIEA
    KSLDRARNAIQGLMQLAPDTATVQGADGTWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITGESLPVDKT
    AGDAVYAGTINEAGSFDYRVTAVAANSTLARIIHAVEQAQGAKAPTQRFVDQFARVYTPIVFAIALLVAVAPPLVVGGAW
    HDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQTDFDLHATD
    VDAARIRHLGASLAARSDHPVSQAIAAAARDAQTAAFAEVDGFEALVGRGVRGTIDGARYWLGNHRLVEELERCSPALEA
    KLDALERQGKSVVMLVDDTRVLGIFAVADTIKDTSRAAIADLHALGIRTAMLTGDNPHTAQAIAQQAGIDDARGNQLPED
    KLAAVEELSAGGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRATHRVLVQNI
    GFALGVKIVFLGLTVAGLGTMWMAVFADAGASLIVVGNGLRLLSKTGVFDSAQTQR

    >gi|172059370|ref|YP_001807022.1| protein-disulfide reductase [Burkholderia ambifaria MC40-6]
    MFNGMALSVRMRAPRFLAILLSFFFALGCLSVARAADDFLDPSVAFKFSASESPGQVDVRFKVANGYYLYRERFAFAVKS
    GQATLGDPTFPPGHVKFDQTFQKEVETYRDEVVIHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVVKVDGAALGATAP
    AGGATASGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFGLLLTAFAVSLISGKDIALPERWQNGAAEASSARQGGHFIAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGIGAGTVLPRAGAWMDSVKVFFGIVLLAAAL
    WIVWPVLAGGLKMVLAALWLLVAAAALGLFTPHAGAASIWRRLGRGLGAALAIWAATLLVGLAAGSNDPVKPLAVLAART
    VASGDAPAAAQQGPAFASVRSSGELDTLLKTSGRPVMLDFYADW
    CVSCKEMEHLTFTDSRVQARLAQLHLVRADVTANNP
    DDQALLKRFNLFGPPGIIFFDRNGHEIGRVVGYQAAETFLRSLDRAAVPTV

    >gi|172059436|ref|YP_001807088.1| glutathione S-transferase domain-containing protein [Burkholderia ambifaria MC40-6]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|172059499|ref|YP_001807151.1| glutaredoxin-like protein [Burkholderia ambifaria MC40-6]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFAAA

    >gi|172059516|ref|YP_001807168.1| protein-disulfide isomerase-like protein [Burkholderia ambifaria MC40-6]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEVNLGTQIIYSDAAGDYVLLGD
    LVDTKTHKNLTDARLSDLNKIDFASLPLANAIKVVKGNGARKIAVFSDPN
    CPYCKRLETTLQSVDNVTVYTFLYPVLSPD
    STTKSKAIWCATDRAKSWEGWMLEHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|172059555|ref|YP_001807207.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MIQVGDALPDAQLFEFIDDARAGCTLGPNAFSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAGQLRSAGIDELWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVEAPGKFEVSDAA
    SVLATLTS

    >gi|172059588|ref|YP_001807240.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MSKVTLGGNPIDLAGTFPAVGSQAPDFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVV
    VVSGDLPFAATRFCTTEGLANVVTASTFRGGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAQLVDEIKDEPNYD
    AALAALK

    >gi|172059590|ref|YP_001807242.1| ribosomal protein L11 methyltransferase [Burkholderia ambifaria MC40-6]
    MSYRELVVELAREHAEALSDALLELGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQHSRVIALLSPDHEPAVLLAAA
    VNDIGVTETPKFDVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALILELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILARKCGANPVVGIDIDPQAVESARQNSERNHAEVTYGLPDACPAGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|172059594|ref|YP_001807246.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MTKRMLALAVVAAAAVAGGLAAGHWFRGGSADDGIAVAAPAAQGNPVDQLWAASLTSVDGKPASLAAFKGQKVVVNFWAS
    W
    CGPCVEEMPELVALSHQYKQKGVRFIGIGVDSDQNVKNFLQKVKVDYPVFVSGYAGADLARNFGNTAGALPFTVVIDET
    GKIRETKLGQIQPAELRKTLDAL

    >gi|172059662|ref|YP_001807314.1| iron-sulfur cluster insertion protein ErpA [Burkholderia ambifaria MC40-6]
    MNAVTESAATTAEMPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|172059749|ref|YP_001807401.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|172059770|ref|YP_001807422.1| peroxidase [Burkholderia ambifaria MC40-6]
    MSLRLGDIAPDFEQETSLGPIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDDVESHKGW
    INDINETQSTVVGFPIIADSDRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLIITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|172059798|ref|YP_001807450.1| DSBA oxidoreductase [Burkholderia ambifaria MC40-6]
    MTTTAAPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADHVDVVLRAYRLMPGQPVEPVEAMLAGKYQMSPAQVD
    QMLRQVTDAAASVGLRYDLPGTSVGDTLDAHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALIDFAVEAGLERSA
    VEAVLRSDAYRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADVFAQALEQAWRDGAIVELAGDDAAACGPDGCEL
    PPRG

    >gi|172059859|ref|YP_001807511.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MQILTAAMLAEWLRDPARPAPVVLDVREPWEISTAQIAGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|172059901|ref|YP_001807553.1| thioredoxin reductase [Burkholderia ambifaria MC40-6]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLVTGIAQGGQLMTTTDVENWPADAKGVQGPELMARFQEHAERFNTEI
    VFDHIHTAKLHEQPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVE
    EALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKEKEGVVDIKWDHVLDEVTGEESGVTGLRIKNVKTGATQDLHVQGVF
    VAIGHKPNTDLFQGQLEMKDGYILTKSGLHGNATSTSVPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRYLEGLHDKK


    >gi|172059952|ref|YP_001807604.1| disulfide bond formation protein B [Burkholderia ambifaria MC40-6]
    MNDSTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFAAIGIFAFLAAGIRNWRVIWVFELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVAAS
    LWRHRRKLAG

    >gi|172060066|ref|YP_001807718.1| glutaredoxin 2 [Burkholderia ambifaria MC40-6]
    MFTLYGRGWCHLCDDMRDALAPVAAESGIEVRYVDIDADPALVARYDEDVPVLLLDGAEVCRHRFDEARVRGALAARR

    >gi|172060125|ref|YP_001807777.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria MC40-6]
    MKRKLLVGAAAALLVAGHALVAQAQLKPGATAPDFTTQASLGGKTYTYSLADALKHGPVVLYFYPAAFTKGCTIEAHAFA
    DAVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSL
    SPDKHVENTLGAVKAWADAHPKQ

    >gi|172060192|ref|YP_001807844.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria MC40-6]
    MPNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERERLGGTCLNIGCIPSKALIHVADAFEQACAQAGEGMLGIRVRAP
    EIDIAKSVAWKDGIVDRLTRGVGALLKKHGVRVLQGDARVVDGKTVDIVAGDHTTRIACEHLLLATGSEPVALPSMPFGG
    HVVSSTDALSPALLPTRLVVVGAGYIGLELGTVYRKLGVEVSIVEAAERVLPAYDAELAKPVADSLARLGVGLWLGHTVL
    GLASDGAVRVQAPDGAQKTLPADRVLVAVGRRPRVDGFGLEALPLDRNGRALRIDDACRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRKFTPASIPAVCFTDPEVVTSGWSPDDAKAAGVDCISASFPFAANGRAMTLQATDGFVRVVARR
    DTHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEAMQEAALRALGHALHV

    >gi|172060355|ref|YP_001808007.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MSELSVEASIGSVDYLVHFTDGVHQWRADEPAALGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLAEVHVKLAHE
    AGSAGSTIVRRITLDGDLSDEQRERLLQIANACPVHKILTHPIAIDTAIA

    >gi|172060484|ref|YP_001808136.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria MC40-6]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGDTEVVTAKNVIIATGSKARH
    LPNVPVDNKIVSDNEGALTFDSVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTANGVSIAYTDKDGNAQTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIAANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|172060686|ref|YP_001808338.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MSKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DTEVDLGMGGDAYFLQARLNVSVPGLDRDVVQHIVDTAHQT
    CPYSKATRGNIDVEIRIV

    >gi|172060788|ref|YP_001808440.1| thioredoxin [Burkholderia ambifaria MC40-6]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|172060823|ref|YP_001808475.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria MC40-6]
    MSVEVDRQVPDFTAPATGGDISLSDLKGRKLVLYFYPKDNTPGCTTEGLQFRELYPKFKKAGAEIIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLIDADGVLRQAWRGIKVPGHVDDVLSAVQAL

    >gi|172060873|ref|YP_001808525.1| hypothetical protein BamMC406_1826 [Burkholderia ambifaria MC40-6]
    MSFSRSAADAADTLPDLAATLGAPALGAFVTLGDAFHTRLPAAPLPAPYVVGFSDEVAQLLGLPASFAAQPGFAELFAGN
    PTRDWPAHALPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQIKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETSAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFYPACRDADDPY
    LALLEAAMLRTADLVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLELERENDAELANKLLETMHASHADF
    TLTFRRLAQLSKHDASRDAPVRDLFIDRDAFDAWANLYRARLSEETRDDAARAAAMNRVNPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQVLRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|172060874|ref|YP_001808526.1| methionine-R-sulfoxide reductase [Burkholderia ambifaria MC40-6]
    MSHDSDDKTYPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKIDHMHGMVRVEVRCNHCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPEKE

    >gi|172060901|ref|YP_001808553.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria MC40-6]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|172060978|ref|YP_001808630.1| arsenate reductase and related [Burkholderia ambifaria MC40-6]
    MAKPRTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLVEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    RSGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFAA

    >gi|172060982|ref|YP_001808634.1| glutathione peroxidase [Burkholderia ambifaria MC40-6]
    MSTLYSFSAETLAGEPASLDAYRGKVLLIVNTASECGFTPQYAGLQKLYEQYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKVDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLVDRDGRIVRRYAPSTKPEEIAADIDKLL

    >gi|172061039|ref|YP_001808691.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria MC40-6]
    MYDVIIIGGSFAGLAAALQLGRARRKVTVLDTGRPRNRFAGHSHGLLGHDHKPPLDILVEARQQLARYPTIRLVDARAES
    VSGAIDDFCVVTDDNESLRARRLILSYGVADQMPDVPGFAESWGTSIVP
    CPYCDGFEVAGLHWGLVWSSPQSYQSAKLFR
    DWTDKLTVFADGHDIAPDIQADLARRNIPVVDGRIIEVAHQKGHITTVNLDTGRNVAVDVLFANPRNKPSASLHESLGLA
    TVDTPTGIVFKVDERRQTSMPGIYAAGDLATPFLPSVTQASSQGAMAGIFAQQSMVV

    >gi|172061079|ref|YP_001808731.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria MC40-6]
    MAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFESHGVKVIVDPKSLAYIDGTQLDFA
    REGLNEGFKFNNPNVKDECGCGESFRV

    >gi|172061090|ref|YP_001808742.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria MC40-6]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTVIAIVEAAA
    GDAAPAKAPEAAKPAPAAPAPAAAAPAAAPAAAPQAGSYSGAADIECDMLVLGAGPGGYSAAFRSADLGMKTVLVERYST
    LGGV
    CLNVGCIPSKALLHTALVIDEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFV
    DPYHMEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYATLGAEI
    DVVEMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEEGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKI
    GADKAGVAVTDRGFIDVDKQMRTNVPHIFAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWA
    GKTEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGK
    TIHPHPTLGESVGMAAELYEGVCTDLPPQRKK

    >gi|172061276|ref|YP_001808928.1| rhodanese superfamily protein [Burkholderia ambifaria MC40-6]
    MTIVNLAAYHFVSIDATEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFIDYIRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDGALDYRI
    DKFSEFPEVIDANRADLEGRTVVSF
    CTGGIRCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTENVTCFACRAVVTPEAQQSPSYVPGKSCPACAQAASAA

    >gi|172061521|ref|YP_001809173.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia ambifaria MC40-6]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESVKPVEPDSPLARRAVEQIERYFERASARFDLPLADVGSPFQHRVWDVIS
    DIAPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQKVKRWLLAHEGVPYR

    >gi|172061527|ref|YP_001809179.1| thioredoxin [Burkholderia ambifaria MC40-6]
    MDTTLATFEKDVIEASLDAPVLVDFWAPWCGPCKTLGPLLEKLEADYQGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFIGVLPEGQLRAFLDRLLPAPEEAERRAAQYAIAESRYDDALTHLEAALALNPGFDDARLDLIELLLANNQVD
    AARTEAERLSPQTVQGADPRYQAIKTRFDALDATADLPPTDALEARIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VMRDRAYGDDLGRRTMLSVFEMAGDSPELVAAWRRKLSMALN

    >gi|172061533|ref|YP_001809185.1| peptide methionine sulfoxide reductase [Burkholderia ambifaria MC40-6]
    MVNEMLETATVGGGCFWCTEAVFLDVDGVTAVQSGYAGGHMRNPGYRDVCEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTQLNRQGNDVGTQYRSVVFTHSDEQRDIALDVIRELEREQVFGQPIVTQVVPLDDNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFSHRLKSLRGA

    >gi|172061794|ref|YP_001809446.1| electron transport protein SCO1/SenC [Burkholderia ambifaria MC40-6]
    MLHSRFGRRARQGWMLACAFAAATLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADETQLKKVTKDFRVYYAKVPG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGPWVHDLKLLVD

    >gi|172061813|ref|YP_001809465.1| glutaredoxin 3 [Burkholderia ambifaria MC40-6]
    MSKVLMYSTQVCPYCIQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIGDTHVGGYDDLSKLDREGGLL
    PLLQAA

    >gi|172061814|ref|YP_001809466.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MTFFTNYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAATDFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVQAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|172061817|ref|YP_001809469.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia ambifaria MC40-6]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHALVVGAGGLGSPAAMYLAASGVGTITLVDADTVDLTNLQRQILHATASVG
    RSKVESGRDTLARLNPEVTVHAVAARVDDAWLDEHVPQAGVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDPAAPCYACVFPEDQPFEEVA
    CATMGVFAPTVGIIGAMQAAEALRVIGAIGTTLSGRLMMLDSLRMEWTTMKIARQ
    TDCPVCQGRH

    >gi|172061828|ref|YP_001809480.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MNTTPPAQRRTGPARYIVAAVVVAAIAVAGFFAFNGRSSVPDATFTLLSGQKVSTAGDLKGKVYLVNFWATSCATCMQEM
    PQMVETYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKNGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|172061873|ref|YP_001809525.1| DSBA oxidoreductase [Burkholderia ambifaria MC40-6]
    MKKLLSTLLLSLGLAVAGFAHASPAAPVSGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNI
    DFKRVPVAFRDDFIPHSKLFYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQGQV
    KQSAELLKSYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDYLVKQVQDKKL

    >gi|172061955|ref|YP_001809607.1| glutathione-disulfide reductase [Burkholderia ambifaria MC40-6]
    MEFDYDLFVIGAGSGGVRLARMSASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHELEDAKGFGWTFGAGTLDW
    PALIAAKDREINRLSDIYINLLRQSGVEMHAGRATLVDAHTVAIGDRTIRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLAKLPERIAVVGGGYIAVEFAGIFNGFGSHVDLFYRGEKILRGFDDDVRHFLTDEMTKQGVAIHARAVVESIVRADDGT
    LGVRVGDAQHGPYDAVLYATGRVPNVEGLGLERAGVLLDARGAIAVDAYSATSVASIHAIGDVTSRPQLTPVATRDGALL
    AATLFGGRRAATDHEWVPSAVFSQPEVATVGLTEAHARGVYGELDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTLRQKVAD

    >gi|172062107|ref|YP_001809759.1| thioredoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MPALNLDTDADRIAERLADPDTLLVACLCAEWCGTCRDYRTAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDANTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRNILNVEA

    >gi|172062128|ref|YP_001809780.1| AraC family transcriptional regulator [Burkholderia ambifaria MC40-6]
    MKTAYPTDDARWGAVTARDPHADGAFFYGVRTTGVFCRPSCASRLPRREHVSFFADPAAARAAGFRPCKRCQPEGLPREL
    DIVNRACAVLDAHPERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALREALQSGQPVTQAAVDAGFNSPS
    RLYASVPRELGMAPSAFRRQGAGLRIDYATASTPLGTVLVAATEQGICRIAFGDEPAPLVDELKAAFARAELVDAPSRLA
    PFVAQIRAYLDGTRHAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGSPRAVRAVASACASNPVALAIP
    CHR
    VVQKGGALAGYRWGVRRKATLLASEARHVRDDETEAVAEGNVV

    >gi|172062143|ref|YP_001809794.1| arsenate reductase [Burkholderia ambifaria MC40-6]
    MMITIYHNPRCSKSRETLALVEALNTTGTPVHIVEYLKTPPTVEELETLHRQLGCPVRDMLRDGEEPYKTLDLARESLTD
    AEAYEAIAAHPILLQRPIVVYRGKAAIGRPPESVRALFE

    >gi|172062299|ref|YP_001809950.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MLSIGPFSIRVVAVAAAALIAWLVARFMQRRPPDGQHKSAASLILDTLLLGLIAARVGYVGQWWSEYSAAPRSIVALGDG
    GFDWRIGVAAALVFAGWRLRRLPALRRPVLAGMLAGFAAWGIAQGTLATLQRGAPPLAAMRLEALDATPVAPQRFAGKPV
    VVNLWATW
    CPPCQREMPILAQAQQDHPDITVLMVNQGEDAQTVRAFLERKGLRFDHVLLDRTLHTMKAYGSHGLPTTLFF
    DANGNLVESHMGEITAARLKDTVSAGLRR

    >gi|172062335|ref|YP_001809986.1| hypothetical protein BamMC406_3300 [Burkholderia ambifaria MC40-6]
    MLFRYSKKSQAARLPRDRIPELHMRAPMDTPQRYTANAPTREEVEALAGATVIEFGANWCGICAGAQSAIVASFAAHPAV
    RHLKIEDGPGRPLGRSFRVKLWPTLVFLRDGVEVARVVRPTDARQIETDGFAALA

    >gi|172062430|ref|YP_001810081.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia ambifaria MC40-6]
    MTLAHLIPSPLGDIAIRIEDDALTGLFFVGQKYYPSLAIAPDADTRNVPSLARKVAEEVAEYFTGTRETFSVPIHLRGTA
    FQRSVWKELLAIPFGELVSYGDITERVGLPMSAARAVGGAVGRNPVSIMVP
    CHRVIGASGSLTGYAGGIERKRALLSLEG
    AGFARGERHPVQQTLAF

    >gi|172062453|ref|YP_001810104.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MTTHPNGIDVPALQQFVQEVATDPTKRNARFNVKTKWAHQTRSVATVSHYELGGVTHQRHFEIAADEPTQLLGTNSAPNP
    QELLMAALNA
    CLTVGYVVNAAAMGITVHSLEIETDGELDLRGFLGLDESVNPGYDEVSYVVRLHTDASRERVEELHRVVT
    KTSVNRANFSKAIRVVSTLEVREG

    >gi|172062455|ref|YP_001810106.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MENWTETIGAVTRRVHELARYTPDTIKGVGLLGAAGAKTNHLDAKTRELIALAVAVTTRCDGCIAFHAAEANKLGVTKEE
    VAEALGVAINLNAGAAVVYSTHVLDALDQLGRE

    >gi|172062456|ref|YP_001810107.1| DSBA oxidoreductase [Burkholderia ambifaria MC40-6]
    MKRVNVEVWSDFVCPWCWIAKRRLEKAIEGMAQHVDVVVTHKSYRLARGMVPTGFTDALYAKFGNPAAAQRMMDAVCSAG
    AQEGLNYRFETMRFGDTSDAHLLVKSVQKLEDKQRLIEAIYRAATTDGVDIFDRAALVELAKNIGISAASLSFDDREMVS
    EIARDEAEANRIANGVPLFVFNNRTYLSGAREVAVFEKALIDSAENVPDESADTGGMSCSIDGCAG

    >gi|172062518|ref|YP_001810169.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria MC40-6]
    MQNHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGQPRNRFAEHAHGFFGQDGKPPARIVADAAAQLAAYPTVQRIAGE
    TRTAERDASGRFHVTLADGSRASADRLILATGIRDVLPALPGLAERWGVSVLH
    CPYCHGYEVSDRQLGVLATHPLSVHQA
    ILIPDWGPTTWFTQRIVEPNEEEAALLDARGVRIERSPVVEILGDAPRIDALRLADGQVVPIDALFIGARTEMASDLAQQ
    LGCAFDEGPLGVAIRVDTWKQTSIPGVFAAGDASSLMTNATFASASGVAAGVGAHRSLIFGLDA

    >gi|172062583|ref|YP_001810234.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria MC40-6]
    MTQQFDAIVIGTGQAGPPLAARLAGAGMKIAIVERGRFGGTCVNTGCIPTKTLIASAYAAQLARRAEEYGVSVGPVSVDM
    KAVKARKDRISGRSNHGVEQWVRGLDNTTVFQGHARFERPDAVRVGDELLEAKRIFINVGGRAQIPQMPGLDSVPYLTNS
    TMMDVDFLPEHLVIIGGSYVGLEFGQMYRRFGSKVTIVEKGSRLIHREDEDVSQAVREILENEGIDVQLDANCLNARRDG
    DGVVVGLDCAGGGREVAGSHLLLAVGRVPNTGDLGLEQAGVATDSRGYITVDDQLRTNVPGIWALGDCNGRGAFTHTAYN
    DYEIVAANLLDGDPRKVSDRIAAYAMYVDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDADS
    HAILGASILGVTGDEVVHALLDVMAAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|172062721|ref|YP_001810372.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MPLIHAAATLAADAPDYVVQLQAGTHALTGDEAPREGGQGLGPAPFEFVLAGLAQCTAATLRMYMQRKTWPAVRIDVHTE
    LHADRDGQQYVRRTVTLEGPLDDAQRQRLAEICEKTPVTLFIKRGTRIETTLN

    >gi|172062793|ref|YP_001810444.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKADAQALVDKAHHV
    CPYSNATRNNVPVRLTVV

    >gi|172062804|ref|YP_001810455.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MPHTHYTTLISAANLAERLAAAPGSVAVFDCRFDLADPAAGEAAYAAGHIPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    FATLMASRGVKQGQQVVAYDAHGGAYAARLWWLLRWLGHDSIAVLDGGLQAWEAAGQPLTTDVPHPSAGDFRAAAPLEST
    VDAAAVLANVTSAQRVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLNADGRFKTGHELRETFTTLLAGTEPNSV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPTP

    >gi|172063013|ref|YP_001810664.1| alkyl hydroperoxide reductase, F subunit [Burkholderia ambifaria MC40-6]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIGSLTSRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPVKLDDDVIEQIRALDGDYAFETYFSLS
    CQNCPEVVQALNVMSLINPRIRHIAIDGALFQ
    NEVEARQIMAVPTMFLNGESFGQGRSSVKEILAKLDTGASARAAKSLEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIILATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGEAKRVDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPATADAPQAEEAIAA

    >gi|172063014|ref|YP_001810665.1| peroxiredoxin [Burkholderia ambifaria MC40-6]
    MPIINTQIKPFKATAYHNGDFVPVTEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIGKIKYPMIGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|172063066|ref|YP_001810717.1| protein of unknown function DUF395 YeeE/YedE [Burkholderia ambifaria MC40-6]
    MQLDALHFTPWLSLGGGVLIGLAAAWLVAFNGRIAGISGIVGGLFTASAAERDWRAAFVAGLIAAPLIMRIAGAAVTPQV
    DAGWGELLAAGLLVGIGTRYAGG
    CTSGHGVCGLSRGATRSIVATAVFMVAGFATVFVRRHVLGG

    >gi|172063186|ref|YP_001810837.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MTQTADSTSRFPVASYQDVRARLLARDELALIDVREEDPYAQGHPLWAANFPLSKLELDAWTRIPRRDTPIVVFGEAGGE
    DLAPRAAATLAQLGYTDVRLLDGGLAGWLAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQALIDAKADVVIVDAR
    RFDEYQTMNIPTSTSVPGAELVLRVRALAPNPQTRVVVN
    CAGRTRSIIGTQSLINAGLPNPVAALRNGTIGWTLAGQTLE
    RGASRRFPDDVDPAQRDEARRAARAVAERAGVPRIALADVAALDEPGRTLYRFDVRTPEEYEAGHLPGFLSTPGGQLVQE
    TDHHAPVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFVERGQPPRDVPATPQVSEVSPATLAGWLKEAAA
    GEIAIVDVTTSANYAKRHIPGAWFVVRAQLRDALAAIPPAKRYVFTCGSSLLARFAAHDARALLPASAAISVLTGGTAAW
    IDAGLPLEHGDTHLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRDGTHHFRVI

    >gi|172063195|ref|YP_001810846.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MQPRLNFYTASPNAIKVMRNAEEFIAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETDRRLATVVAWRETPF
    FTERERAALEWTEALTLVADNHVPDSVWEAVKPHFSDTELFELSMLIATINTWNRFAIAFRKMPE

    >gi|172063281|ref|YP_001810932.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWTSMFAAAIGATMLADSLWFFMGRTRGRRLL
    NGLVRFSLSLDTTLRFARNVFERYGAPLLVISKFLPGLGLVSAPLLGTTAIGVGVFLFWDLAGASLWAAVWLVGGAAVHD
    QIVQFVLWVRSSGGTILDAFLAIFITFVLYRWVRRVQFRRYLAQLRISPPQLVEMMTSNEPPLIFDARPRAIREREPYRI
    AGAVPVDLDSPDLLDPELLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMLHNIRALKGGLDAWEKHGYPVEPMPADADASRY
    FVRPAHAAPLEGEYTVRATLSK

    >gi|172063645|ref|YP_001811296.1| heavy metal translocating P-type ATPase [Burkholderia ambifaria MC40-6]
    MASGTPDSATLDVRGMWCTSCANALERVLQRQPGALDARVSFASESATVEWDPRRTSLDHLLAAAAKLGYECAPENETPD
    RRAHTAALLDDLTLRLVIAAFCSMWVMTAQTTLYFTTAATVPEPVRHGLAVLAGIATLPVVGYCAQPFFKAAWRTLRARV
    PGMDCLVAMGTSASFLLSLWRVAYGESTVYFDSAAMIVTFLLAGRWLELRVRSRMSDAVRALLDLPAQTARVLASDGAQT
    VVLAKRVATGSIIRVLPGDRLPLDGVVTDGRSSLDRSLLTGESELVGVERGSFVEAGALNADGELLVCVKYGWGERRVDS
    IAASVRAMLARKTASQAIAERFTRRLVPAIAMVALLVFVGGGLLGMGWADALERAVAVLVVTCPCALGMAVPLALSAGVG
    RAAREGILFRDVEAIEKAGELRMFFLDKTGTLTEGKPRLVSARAASGVREAELIEEAARAERGSEHPIAAAIRALVAPDR
    LAGAVDAPRGTSRAVPGAGVAWEGADGECILAGTAAFLRSHDVQVPDIDDANTAVHVARNGCWRGMLGFADRPREGATDA
    VASLRAHGATVSMLTGDRPIVARAIAQAVGLADDSILAAQSPERKAAHIVHAQAAGRGAVAFVGDGLNDAPALAAADVGI
    AVGSASPASMAAASIVLVDAGIEKLDLALRLARRTARVMHQNLAAAVVYNALAIPAAVFGCVSPATAAALMVASSMSVTL
    NAGRLAVRTDRPPAPTGTSRPARALSTEQTWSPS

    >gi|172063879|ref|YP_001811530.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MSYVTDVPAADSAAALAHFEASLGFETDCWDVHDALASGAPDFVLLDVRSPELFSAGHVPGARNLPHRKIVAGKLAEHPA
    DTLFVVY
    CAGPHCNGAARAAIRLARLGRPVKLMIGGITGWLDEGFALSNDAEAKDVAAR

    >gi|172064006|ref|YP_001811657.1| methylamine dehydrogenase accessory protein MauD [Burkholderia ambifaria MC40-6]
    MMQTALTVSTALLWVAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGAIAPTFELTDIRGSRIKVGGIDAAGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQASESTPVNIVLASDGELAEHTRFAQKHDLARFPYVLSQELGLAYQIGKLPYAVLLD
    DTGTVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHDHGGHEEHAQHA

    >gi|172064154|ref|YP_001811805.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MLPRLKTAALVIAIAATAGLAAFAGTRDDAGMTASLAGTPAPDFTGIERWQNSAPLKLAQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDPKNVADALKRFDIQYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIREALVQAQAQAGEGTKGAMRTQ

    >gi|172064248|ref|YP_001811899.1| selenide, water dikinase [Burkholderia ambifaria MC40-6]
    MTEATLTPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIV
    DDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAILRGGESVCAEAGIPVAGGHSIDSVEPIYGLAAI
    GVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDAAGYAQMVATTTKLNRPGAELAALPGVHALTDVTGFGLL
    GHTLELARGANLTARVHYASLPWLAGVEAFVADGVFTGASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVACAP
    EAVDDVLACFRADGFDRAAVIGEMVDGPSRVDVA

    >gi|172064264|ref|YP_001811915.1| glutathione S-transferase domain-containing protein [Burkholderia ambifaria MC40-6]
    MTMPSLTLISHPLCPFVQRAAIVLLEKQLAFERINVDLNAKPAWFLALSPTAKVPLLQIQQPDGEEEILFESMAICEYLD
    ETQPGPHLYPANPLARAKHRAWIEFGSATLGEAWGYLNAKDHASAEVKATSFKERLVQLENVPGLGPYFDGETFGMVDAV
    FAPLFRYFDTLEIDGVASIFADVPKINAWRRNLRGRASVIGAVSVDYQALFLAHLRRQKAVLAEKM

    >gi|172064299|ref|YP_001811950.1| uncharacterized peroxidase-related enzyme [Burkholderia ambifaria MC40-6]
    MTAADNAPVSRFPVPALDDLPDDIRERIAAVQEKSGFIPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLTKAEREMIVVA
    TSAVNQCQY
    CVIAHGAILRIRAKDPLLADQVATNYRKADITVRQKAMLDFAMKVSQTAHLVGEADFDTLKSHGFTEEDVW
    DIAAISAFFGMSNRIANVTNMRPNAEFYALGR

    >gi|172064364|ref|YP_001812015.1| beta-lactamase domain-containing protein [Burkholderia ambifaria MC40-6]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALLDELGLRLVATVDTHVHADHVTGAWLLKQRTGSTIAIS
    AASGALGADRYLNDGDRCAFGTRYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDTHVAP
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFTGPLGHLPGATPIPLGELAARTGELARDRPIVTV
    CRAGGRSA
    QATVILLKAGFDAVANLGGGMLRWRGEGRVVMDGRS

    >gi|172064382|ref|YP_001812033.1| heavy metal translocating P-type ATPase [Burkholderia ambifaria MC40-6]
    MTESLASAGLQTIELTIDGMHCGGCTGRVERALAAVPGVVEAAVDLDAQAATVTAQDTVEPAQLVDAVGAAGYRATVREA
    AFEAVAAAQAEPAPRVEALHAAPAAPPAPAATIELEIDGMT
    CASCVSRVEKALAKVPGVTRASVNLATERATIDAAPDVS
    ASRLAEAVQQAGYGATAVAATPPPAASRDLEFDIGGMT
    CASCAGRVEKALAAVPGVARASVNLATERASVHGAGALDAAA
    LIAAVTTAGYRASLAAAPDAGTGAAAEVPAGDAAQAPEARKRREAIRERNLVIGSAVLSAPLIVSMLVAPFGIDAMLPGW
    LQLVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAFGLSLWMLVRDPVDPGHLYFEASAVIVTLVRFGKWLE
    ARAKRQTTEAIRALNALRPDRARVVEHGVERDVPLAQVRVGTTVSIRPGERVPVDGRIVSGRSHVDESLITGESLPVPKD
    DGDPVTAGSINGEGALVVATTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLIGWLIAGAGTE
    TAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVTAFDAVGVPR
    EQALALAAAVQRQSDHPLARAVVAAHEADVVARGVAAGSTDIVAADARAVAGRGVQAHVDGQLLALGSTRWRDELGIDVP
    PELDARAAELEHAGNTISWLMRADAPRALLALIAFGDTVKPGARDAIAALSARGVASVLVTGDNRGSAAAVAAALGIGEV
    HAQVLPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAIDISKRTY
    RKIQQNLFWAFVYNLIGVPLAALGWLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|172064412|ref|YP_001812063.1| thioredoxin domain-containing protein [Burkholderia ambifaria MC40-6]
    MKTVLRNLTAACLFAAAGAAFANPAPQGAAVSSPSGDGAHLPPGIAWQQGDVDAAFALAKRTGKPLLLYWGAVWCPSCNQ
    VKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLERYMQALSLGMTAAHP
    VRQTLATALNNGASLTPDEWHLLADYSWDTDGALPVPPDRVAVTLQTLSQRARAAGAKADAARFALKSAVVAAADDPAQA
    GALDKAALADALRAVLREPALARADSDVLVAAPARVVAYLGGDAAQRAKLRGAYDTALARLSTDTTLSSIDRLMALHGRV
    LLARGDAHDGVPLAAPAPALVDAARKQIAASVQGAANPYERQALVSEAADTLTDAGLYDESDVLLKAELPRSATPYYFMS
    GLAANAKARGDKAAALDWYRKAYDSASGPATKLRWGATYFANAVALAPDDSARIEAIAASVLAQAGKTRDAFYGANLRAL
    TKVVTQLNRWRGGGGAHEESVRSVVKQFDGVCAKLPAGDPQAAACAKLIQPVKA

    >gi|172064416|ref|YP_001812067.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MLRDLVAQYGPLLVFTNVLAAAIGLPVPAMPTLVLFGAMAAMHPAMIGSQLVTVLALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLVAGLVFY
    RQIDWLFAGAGRLGRAVLLVIVALLAIYAAVRWMRRRALIRQLASARIGVDELDRLLGDASAPVVLDVRSPEHRKLDPFT
    IPGAQFADERRIDDIVARYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALPLRGGLDAWRDTGRQLTSLVEEVPAAN
    DPVAGLHKPA

    >gi|172064844|ref|YP_001815556.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MDDKTLQAPPLSLLDRYRGRDFQSLYATTVTVTGGETGHGRASGVVRSDDGNLAVDLRLPTEFGGPGNGTNPEQLFAAGF
    AACFHGALNLLEKRAEMAITDMAVEVQVSFGRDPMDGGYALLVDVRVRMPGIDRSIAEEMVRTAERL
    CPYAKMARQGTFN
    IVTVVD

    >gi|172064850|ref|YP_001815562.1| rhodanese domain-containing protein [Burkholderia ambifaria MC40-6]
    MMSHEMISRYGTLIVFLNVFGASLGLPLPAIPTLITVGAGVALVTHVASSTLLHFSTILGAAVIGGFLGDLVWFQGGKRY
    GKRTLHTVCKLSQSREACVRTTERFFGRWGVRVLIVARFVPGLSLVAVPLCGAMAVRLRSFVLHDCAGITLWASIGLAIG
    TLFASQIDAIFAFVARLGWRALIVVVIVPVLYVLYRYCRRLMLANALGKARISAGELHALLANHPRPVVIDIRSAERRML
    DPFLIPGAVIGDERKTRQIMERHGTNRTLVIYCA
    CPNEVSAVSVARQLRLSGIKLALPLAGGIEAWRAAGFDVEPMIATH
    EPAIG

    >gi|172064860|ref|YP_001815572.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MENKRLQPPSLTLLDKYRGRKFAVLYTTTVTVSGGESGHGRASGVARSDDGCLIVDLRLPAELGGPGGGTNPEQLFAAGY
    AACFHGALSLLAKRERIDIRETTVAVEVSFGRDPVDGGYALTANITLRMPGVDPQVAERLARDTERL
    CPYTKMARQGICS
    VVVVSA

    >gi|172064861|ref|YP_001815573.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MTQRINYFQQSPEFTKKLVELDGLFQKTTIEVPVRELVEIRASQLNGCAFCVDMHVKAARIHGERELRMHHVAIWRESTL
    FSPRERAALAWTEALTHLQSDGVPDELYERVRTHYSEKELSDLTFLVGAINCWNRLNVAFRIVPGSFDKTFGLDKANLE

    >gi|172064996|ref|YP_001815708.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MSIEKVLYRAYAKATGGRDGRATVPESGLDLKLTTPRELGGAGGAGANPEQLFAAGYSVCFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRETAQTLIDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|172064998|ref|YP_001815710.1| methionine-R-sulfoxide reductase [Burkholderia ambifaria MC40-6]
    MPTRRHLLFAGAAGLATLAALSSAGRRALVGRAFAAPPAAPFEITRSDAEWRRRLTPAQYTVLRNAGTEPPYSSPLNAEH
    RRGTFACAGCDLALFSSDTKFDSHTGWPSFWKPLDHAVATETDPSYGMARTEVHCRRCGGHLGHVFDDGPPPTGLRY
    CMN
    GLALAFHPAAA

    >gi|172064999|ref|YP_001815711.1| cytochrome c biogenesis protein transmembrane region [Burkholderia ambifaria MC40-6]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLIGMALTFAVVATLAAVGGGWVAQANQAGRWLAIVLLA
    VFGLTLLLPRFAEHLTRPLVAAGNRLTGFAQRDGRPAGPLSSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTVL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGAALLAGVGAIALGLDTGALAQLSTVTTGSLETKLVDRLG
    GRSNGAPAAPSSTSNTGNAGSGTASGAMMAAATDGAPAAGSAMMRTAGTTPAMQAAALPVEGTLPSLDGAVQWLNSPPLT
    AAGLRGKVVLVDFWTYS
    CINCLRTLPYTTAWAHKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNGYAI
    WRAFGNEYWPAHYFVDAQGRIRHHHFGEGEYAQSERAIQSLLAEAGHPEALNVPLGLTGAPAKGALAAADSADVRSPETY
    VGYARAEDFTSPGGVVHDTAHRYDAPAHPDLNDWGLAGTWQVGAERATLAAPAGRIVYRFHARDLHLVLGPGATGKPVRF
    RVTLDGAAPGSAHGADVDAQGYGTVTGQRLYQLVRQPGAIADRTFSIEFLDPGVDAYAFTFG

    >gi|172065000|ref|YP_001815712.1| peptide methionine sulfoxide reductase [Burkholderia ambifaria MC40-6]
    MIPTSTRSSAPKRAATLRRIGAIALAAAAVFGYQRVVSSAEPMRTVPAPTLDETPGTSHEETAVIAGGCFWGVQGVFEHV
    KGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVFDPTQVTYGRLLQVFFSVAHDPTELNRQGPDEGSQYRSAIFPT
    TAQQRAVATAYIAQLGTAHAFASPVVTRVEPYKGFYPAEAYHQNYLELHPDAPYIAFNDMPKVAGLKQRFPALYRPDAVL
    WRDAHL

    >gi|172065364|ref|YP_001816076.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MSKRLDYNQIAPAGVKALGGVYGYVMQSGLSPVLVDLVYLRVSQINNCAYCLDMHTRDLLKKGVKVEKLALVQAWREAGN
    LFDERERAALAWAESVTLVAATGVPDDAYEAARAVFDEREIVDLTIAVSLMNTYNRMAISFRNTPQAVLEQ

    >gi|172065420|ref|YP_001816132.1| glutathione-disulfide reductase [Burkholderia ambifaria MC40-6]
    MKHYDYIAIGGGSGGIASVNRAAMHGKKCALIEAKEIGGTCVNVGCVPKKVMWYAAHIADAIRHYSSDYGFNAEIERFDW
    ATLVKNRSAYIDRIHASYETSLDRNKVDVIAGFGRFVDTRVVEVNGERMTANHILIATGCRPSRPDIPGAEHGIDSDGFF
    ALREMPARTAIIGGGYIAVELAGVLNALGSQTHLFVRKNTPMRHLDPLLSDTLVEVMKSDGPTLHTHAIPKAIQKNPDGS
    LTLQLEGGESYIADCIVWAIGREPHTDDLNVQATGVAIDNRGYVIVDKYQNTTVPGIYAVGDITGLLDLTPVAVAAGRRL
    SERLFNNKPHEHLDYNNVPTVVFSHPPIGTVGLTEPEARMKYGDDGVKVYQATFTSMYSAVTQHRQPARMKLVCVGPDEK
    IVGIHGIGSGMDEILQGFAVALKMGATKRDFDNTVAIHPTAAEEFVTMR

    >gi|172065425|ref|YP_001816137.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MAEQRFDFHGAHGTLLSGRLESPQTTPRGWAIFAHCFTCGKDSVAAARIARALALSGIGVLRFDFAGLGGSEGEFANSTF
    AADVDDLVAAGRAMTASGRAPSLLIGHSLGGAAALAAAADMPSVQAVATIGAPSSVEHVLGLFGSDSLAQIEADGEAEVL
    LAGRPFTFRKSFLDDARQQKLEDRIARMHKPLLVMHAPGDRIVDIQHATRIFVAAHHPKSFVSLDDADHLLTRRPDSDYV
    ASVVAAWAVRYLPAAAADIPDISEGDGVLAEETGKGLFQLAMRSGKHQFLADEPESVGGMASGLSPYEFVCAGLAA
    CTVM
    TMRMYARRKGIPLVRASTRVTHSKRPDQTPADLFARTISLEGPLDDEQRQKLLAIADRCPVDLTLVRGSDVSTTLETESE
    KLVIQSND

    >gi|172065428|ref|YP_001816140.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MMQDWNSYRDNLLERVGDYAKQSPEVVRGLMTIDNAAAKTGHLEAKMHELIALAVAVTTRCDGCISVHTKKAVEAGASLE
    EISEALGVAIALNAGAALTYSARVIETYQQLPNK

    >gi|172065435|ref|YP_001816147.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MKMNGIDLVALGAMADKARNSGENATAKFKVKTKWMGQTKTVGVVSEYVLFDETFNRHFDISSDEPRELLGENSAPNPQE
    LLMAALNA
    CMSVGFAANAAAMGIKLDKLEIETVGELDLRGFLGIDPAVKPGYEEVHYTVRVKSDASREQLEELHRSVVKT
    SPNFSNFSTAIKMVPEFIIEHL

    >gi|172065505|ref|YP_001816217.1| alkylhydroperoxidase [Burkholderia ambifaria MC40-6]
    MSNSLRYRERTAEVSEQMRKLRQSQPDFLSAFGALGAAGTKEGALTKKTRELIALGIAISCRCDDCIGFHMQSLIKLKVT
    REEIEEVAGVAVYMGGGPSMMYAAHALIAFDELST

    >gi|172065752|ref|YP_001816464.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MNHETKILYTGEVRTTGGRDGAAHSADGRLDVKLSAPGSAAPGTNPEQLLAAGWSACFIGAMGLAAQKLKVSLPRDTHVD
    AQIDLATNDGAYFLQARLNVSVPGVDADVAQALVDAAHQT
    CPYSKATRGNIDVVVTVA

    >gi|172059658|ref|YP_001807310.1| OsmC family protein [Burkholderia ambifaria MC40-6]
    MECKVSWMGQDGMAFSAQTGSGHLVAMDGAPEGGGHNLAPRPMEMVLVGTGGCTAYDVVLILKKSRQEVTGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAD