Burkholderia ambifaria AMMD uid58303

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|115350069|ref|YP_771908.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MTAKLNPFAAAPALMKSWMTVSVAAAGSLEPTLIELVKIRASQINACANCLNMHTVEAREQGETEQRINLLAAWREAPCY
    TDRERAALGWTDALTRLSEGHGAHEAAYAALNDHFSQEEQVKLTLMINVINGWNRLAVGFGLWIDPAEAKAAAAKMVA

    >gi|115350170|ref|YP_772009.1| heavy metal translocating P-type ATPase [Burkholderia ambifaria AMMD]
    MQMDCPTEETLIRKKLGGMQQVSALEFNLMQRMLTVEHVPGAQPAIESAIRTLGMTPEAAAADAPATPVAPPPAKPWWPL
    ALAGVAAIASEAVSWAGLPVWLSAVLALAAVLACGLTTYKKGWIAIRNGNLNINALMSIAVTGAMAIGQWPEAAMVMVLF
    TIAELIEAKSLDRARNAIQGLMQLAPDTATVQGVDGTWRTIEAAQVALGAVVRVKPGERIGLDGEVVAGRSTVNQAPITG
    ESLPVDKTAGDAVYAGTINEAGSFDYRVTAVAANSTLARIIHAVEQAQGAKAPTQRFVDQFARVYTPIVFAIALLVAVAP
    PLVMGGAWHDWIYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEEGRKLAWLALDKTGTITHGKPVQT
    DFDLHATDVDAARVRHLGASLAARSDHPVSQAIAAAARDAQATAFAEVDAFEALVGRGVRGTIDGTRYWLGNHRLVEELE
    RCSPALEAKLDALERQGKSVVMLVDDTRVLGIFAVADTIKDTSRAAIADLHALGIRTAMLTGDNPHTAQAIAQQAGIDDA
    RGNQLPEDKLAAVEELSAGGAGAVGMVGDGINDAPALARADIGFAMGAMGTDTAIETADVALMDDDLRKIPAFVRLSRAT
    HRVLVQNIGFALGVKIVFLGLTVAGLGTMWMAVFADAGASLIVVGNGLRLLSKTGVFDGAQTQR

    >gi|115350351|ref|YP_772190.1| protein-disulfide reductase [Burkholderia ambifaria AMMD]
    MFNGMALSVRMRAPRFLAILLSFIFVLGCLSVARAADDFLDPSVAFKFSASESPGQVDVRFKVANGYYLYRERFAFAVKS
    GQATLGAPTFPPGHVKFDQTFQKEVETYRDEVVIHVPVKQAAGPFELAVTSQGCADEGICYPPAEHVVKVDGAALGATAP
    ADGATASGSWFDKVTSADFAQSLLEGHGFFTIVALYFVAGVVLSLLPCSYPMIPIVSAIIIGQGTRATHARGFALSLTYV
    VGMALVYTVLGIAAALVGQSLGAWLQNPWVLGAFGLILTAFAVSLISGKDIALPERWQNGAAEASSARQGGHFIAVAAMG
    ALSALVVGACMTAPLFAVLAFIAHTGNALLGGAALFAMGLGLGVPLLVVGIGAGTVLPRAGAWMDSVKVFFGIVLLAAAL
    WIVWPVLAGGLKMVLAALWLLVAAAALGLFTPHAGAASIWRRLGRGLGAALAIWAATLLVGLAAGSNDPVKPLAVLAART
    VASGDAPAAAQQGPAFASVRSSGELDTLLKTSGRPVMLDFYADW
    CVSCKEMEHLTFTDSRVQARLAQLHLVRADVTANNP
    DDQALLKRFNLFGPPGIIFFDRNGHEIGRVVGYQAADTFLRSLDRAAVPTV

    >gi|115350417|ref|YP_772256.1| glutathione S-transferase domain-containing protein [Burkholderia ambifaria AMMD]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLLNFEKELFVHVSTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|115350466|ref|YP_772305.1| glutaredoxin-like protein [Burkholderia ambifaria AMMD]
    MDTQQRIKQIVDENQVVLFMKGNAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDDEIRQGIKEFSNWPTIPQLYVKGEF
    VGGSDIMMEMYQSGELQQLFAAA

    >gi|115350485|ref|YP_772324.1| protein-disulfide isomerase-like protein [Burkholderia ambifaria AMMD]
    MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEVNLGTQIIYSDAAGDYVLLGD
    LVDTKTHKNLTDARLSDLNKIDFASLPLANAIKVVKGNGARKIAVFSDPN
    CPYCKRLETTLQSVDNVTVYTFLYPVLSPD
    STTKSKAIWCATDRAKSWEGWMLDHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
    SK

    >gi|115350523|ref|YP_772362.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MIQVGDALPDAQLFEFIDDARAGCTLGPNAFSVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRSAGIDELWC
    VSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVEAPGKFEVSDAA
    SVLATLTS

    >gi|115350557|ref|YP_772396.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MSKVTLGGNPIDLAGTFPAVGSQAPDFKLVGKDLADLSLASFAGKRKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVV
    VVSGDLPFAATRFCTTEGLANVVTASTFRGGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAQLVDEIKDEPNYD
    AALAALK

    >gi|115350559|ref|YP_772398.1| ribosomal protein L11 methyltransferase [Burkholderia ambifaria AMMD]
    MSYRELVVELAREHAEALSDALLELGALSVSVEDADADTPDEQPLFGEPGLVPDRTAWQRSRVIALLSPDHEPAVLLAAA
    VNDIGVTETPKFDVREVEEQDWVRLTQSQFEPIPIGERIWVVPSWHDAPDPDALILELDPGLAFGTGSHPTTRLCMEWLE
    QSVKPGQSVLDYGCGSGILAILARKCGANPVVGIDIDPQAVESARQNSERNHAEVTYGLPDACPAGEFDIVVANILSNPL
    KLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDISVWREHEGWV
    CLAGTRRESH

    >gi|115350563|ref|YP_772402.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MMTKRMLALAVVAAAAVAGGLAAGHWFRGGSADDGVAVAAPAAQGNPVDQLWAASLTGVDGKPASLASFKGQKVVVNFWA
    SW
    CGPCVEEMPELVALSHQYKQKGVRFIGIGVDSDQNVKNFLQKVKVDYPVFVSGYAGADLARNFGNTAGALPFTVVIDE
    TGKIRETKLGQIQPAELRKTLDAL

    >gi|115350629|ref|YP_772468.1| iron-sulfur cluster insertion protein ErpA [Burkholderia ambifaria AMMD]
    MNAVTESAATTAEMPVPFVFTDAAADKVKQLIDEEGNPDLKLRVFVQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
    DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV

    >gi|115350720|ref|YP_772559.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MLNWNEYRKELSTRIGDIAKLSPDTLAGYKALSGAGAKTGHLDAKTRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEE
    VAEALGVAIALNAGAALVYSARVMDALGD

    >gi|115350747|ref|YP_772586.1| peroxidase [Burkholderia ambifaria AMMD]
    MSLRLGDIAPDFEQETSLGPIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTSKLKGEFEKRNVKVIALSVDDVESHKGW
    INDINETQSTVVGFPIIADSDRKVSQLYDMIHPNANETLTVRSLFVIDPNKKVRLFITYPASTGRNFDEVLRVIDSLQLT
    DNYKVATPGNWKDGDDVVIVPSLQDPEELKKRFPKGFNAVRPYLRLTPQPNK

    >gi|115350775|ref|YP_772614.1| DSBA oxidoreductase [Burkholderia ambifaria AMMD]
    MTTTPAPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHAGHVDVVLRAYRLMPGQPVEPVEAMLAGKYQMSPAQVD
    QMLHQVTDAAASVGLRYDLPGTSVGDTLDAHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAALIDFAVEAGLERSA
    VEAVLRSDAYRDEVEADIARAAQIGGRGVPLFVFGGRYAVSGAQPADVFAQALEQAWRDGAIVELAGDDAAACGPDGCEL
    PPRG

    >gi|115350842|ref|YP_772681.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MQILTAAMLAEWLRDPARPAPVVLDVREPWEISTAQIAGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLES
    RGFTKLYNLQGGIDAWSRDVDPSVPRY

    >gi|115350888|ref|YP_772727.1| thioredoxin reductase [Burkholderia ambifaria AMMD]
    MTASRSTQTVRRALSRPPRPPFTDSHMSTPKHAKVLILGSGPAGYTAAVYAARANLSPVLVTGIAQGGQLMTTTDVENWP
    ADAKGVQGPELMARFQEHAERFNTEIVFDHIHTAKLHEQPIRLIGDSGEYTCDSLIIATGASAQYLGLPSEEAFMGKGVS
    A
    CATCDGFFYRNQEVAVIGGGNTAVEEALYLTGIAKKVTVIHRRDKFRAEPILIDRLLEKEKEGVVDIKWDHVLDEVTGE
    ESGVTGLRIKNVKTGATQDLNVQGVFVAIGHKPNTDLFQGQLEMKDGYILTKSGLHGNATSTSVPGVFAAGDVQDNVYRQ
    AITSAGTGCMAALDAQRYLEGLHDKK

    >gi|115350939|ref|YP_772778.1| disulfide bond formation protein B [Burkholderia ambifaria AMMD]
    MNDSTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFAAIGIFAFLAAGIRNWRVIWVFELLIAIA
    AAGGVGTAARHLSIQMNPGFS
    CGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVASS
    LWRHRRKLAG

    >gi|115351061|ref|YP_772900.1| glutaredoxin 2 [Burkholderia ambifaria AMMD]
    MFTLYGRGWCHLCDDMRDALAPVAAESGIEVRYVDIDADSALVARYDEDVPVLLLDGTEVCRHRFDEARVRGALAARR

    >gi|115351124|ref|YP_772963.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MKRKLLVGAAAALLLAGHALVAQAQLKPGATAPDFTTQASLGGKTYTYALADALKHGPVVLYFYPAAFTKGCTIEAHAFA
    DAVDRYKAYGATVIGVSADNIDTLTKFSVSECRSKFPVAADPDAKIIREYDAKLPALDRANRVSYVISPEGKVLYEYTSL
    SPDKHVENTLAAVKAWADAHPKQ

    >gi|115351179|ref|YP_773018.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria AMMD]
    MPNEHTTLLVIGGGPGGYVAAIRAGQLGIPTVLVERERLGGTCLNIGCIPSKALIHVADAFEQACAQAGEGMLGIRVRAP
    EIDIAKSVAWKDGIVERLTRGVGALLKKHGVRVLQGDARVVDGKTVDIVAGDHTTRIACEHLLLATGSEPVALPSMPFGG
    HVVSSTDALSPTSLPTRLVVVGAGYIGLELGTVYRKLGVDVSIVEAAERVLPAYDAELAKPVADSLAQLGVGLWLGHTVL
    GLASDGAVRVQAPDGAQKTLPADRVLVAVGRRPRVDGFGLEALPLDRNGRALRIDDACRTSMRNVWAIGDVAGEPMLAHR
    AMAQGEMVAELIAGRRRKFTPASIPAVCFTDPEVVTSGWSPDDAKAAGVDCISASFPFAANGRAMTLHATDGFVRVVARR
    DTHLIVGWQAVGRGVSELAAAFSQSLEMGARLEDIGGTIHAHPTLGEAVQEAALRALGHALHV

    >gi|115351320|ref|YP_773159.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MSELSVEASIGSVDYLVHFTDGVHQWRADEPTALGGGDAAPTPVALLLSSLGACTAITLKMYAQRKGWPLAEVHVKLAHE
    SGSAGSTIVRRITLDGDLSDEQRERLLQIANACPVHKILTHPITIDTAIA

    >gi|115351445|ref|YP_773284.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria AMMD]
    MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGALKLGGTCLNVGCIPSKALLASSEEFENTSHHLADHGIT
    VDGVKIDVAKMLGRKDAIVEKMTSGIEFLFKKNKITWLKGHGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARH
    LPNVPVDNKIVSDNEGALTFESVPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEALAKEAAKLFKKQGL
    DIHLGVKIGDVKTTADGVSIAYTDKDGNAQTLDADRLIVSVGRVPNTDNLGLEAIGLKANERGFIDVDDHCRTAVPNVYA
    IGDVVRGPMLAHKAEDEGVLVAEVIDGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGREIKSGKFPFSINGRALGM
    NAPDGFVKMIADAKTDELLGVHVIGANASDLIAEAVVAMEFKAASEDIARICHPHPSMSEVMREAALAVDKRSLNS

    >gi|115351665|ref|YP_773504.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MSKIEKVLYTGKTHTTSGGRDGAARSSDGRLDIQLSSPGSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPADLAV
    DTEVDLGMGGNAYFLQARLNVSVPGLDRDVVQHIVDTAHQT
    CPYSKATRGNIDVEIRIV

    >gi|115351817|ref|YP_773656.1| thioredoxin [Burkholderia ambifaria AMMD]
    MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDDNQATPAKFGVRGIPTLI
    LFKNGAAAAQKVGALSKSQLTAFLDSHL

    >gi|115351853|ref|YP_773692.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria AMMD]
    MSVEVDRQVPDFTAPATGGDISLSGLKGKKLVLYFYPKDNTPGCTTEGLQFRDLYPKFKKAGAEVIGVSRDSLRSHDNFK
    AKLELPFPLISDADEALCALFDVIKMKKMYGKEVRGIERSTFLIDADGVLRQAWRGIKVPGHVDDVLSAVQAL

    >gi|115351947|ref|YP_773786.1| hypothetical protein Bamb_1896 [Burkholderia ambifaria AMMD]
    MSFSRSAADAADTLPDLAATLGAPALGAFVTLGDAFHTRLPAAPLPAPYVVGCSDEVAQLLGLPASFATQPGFAELFAGN
    PTRDWPAHALPYASVYSGHQFGVWAGQLGDGRALTIGELPGTDGRRYELQIKGGGRTPYSRMGDGRAVLRSSIREFLCSE
    AMHHLGIPTTRALTVIGSDQPVVREEIETSAVVTRVSESFVRFGHFEHFFSNDRPDLLRQLADHVIDRFYPACREADDPY
    LALLEAATLRTADLVAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFVDAFDANHICNHSDTSGRYAYRMQPRIAHWNCY
    CLAQALLPLIGLQHGIADDDARAERAVDDAQAVLAKFPERFGPALERAMRAKLGLELERENDAELANKLLETMHASHADF
    TLTFRRLAQLSKHDASRDAPVRDLFIDRDAFDAWANLYRERLSEETRDDAARAAAMNRVNPKYVLRNHLAEVAIRRAKEK
    DFSEVERLAQVLRRPFDEQPEHEAYAALPPDWAGSLEVS
    CSS

    >gi|115351948|ref|YP_773787.1| methionine-R-sulfoxide reductase [Burkholderia ambifaria AMMD]
    MSHDTDDKTYPYQKDDAELRRRLTPMQYEVTQHAATERAFTGEYTDTEDAGIYKCVVCSTPLFESGAKFHSGCGWPSYFK
    PLNGEVIDEKIDRTHGMVRVEVRCNHCGAHLGHVFEDGPRDKTGLRY
    CINSAALNFESRPENE

    >gi|115351979|ref|YP_773818.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria AMMD]
    MKTVGDKLEAFTVVAAKPGFNNHEENGQSAFETVTEASFPGKWKIIYFYPKDFTFVCPTEIVEFAKLTKQFEERDAVLLG
    GSSDNEFVKLAWRREHKDLDKLNHYSFGDVKGELIDQLGVRDKEAGVALRATFIVDPDNTIQHVSVNNLNVGRSPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|115352025|ref|YP_773864.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria AMMD]
    MTRMKVDVAIIGAGSAGMTAYRAAKAHTDSVVVIEGGVYGTTCARVGCMPSKLLISAANAAHALKMAPSFGVNPGMIEVN
    GRKVMHRVRSERDRFVGFVVETVEGWPEAHRLRGTAKFLSPHELLVGSTIVEADRIVVATGSSPYVPEGWHEALGDRQLI
    NDDVFDWADLPGSVAVVGTGVIGLELGQALHRLGVRVRLYGRSRSIGPLTDPAVAAEATRIFSDEVPVSLGATISPKLTT
    DRRVSITSIDEHGVHSTEIYDYLIVATGRRPNTSGLDLELAGVRLDSSGQPVFDRATGQSAPSHIFIAGDVNGMTEILHE
    AADDGRIAGDNAGRFPLVRPRPRRAPLGIVFSDPQIAMIGSTFQQLTASGAAFEIGESSFADQGRSRVMLENRGMIRVYA
    DTATGVFLGAEMVGPASEHIGHLLSWSVQRGDTVQQMIDSPFYHPVVEEGVRTALRHLQRKLALVPQAPESCLDCVPGA

    >gi|115352026|ref|YP_773865.1| thioredoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MSVPAWVGKVEELDATEFNRLARSTTDPLLLYIGARWCPPCKTMEPAFDAAAAAMGDQVRFLKVNAATDPQLLNSLKVAG
    VPTLLLYDEHGQELGRFLGALTASGISRWVQTRLVESRQ

    >gi|115352027|ref|YP_773866.1| thioredoxin [Burkholderia ambifaria AMMD]
    MATRSTTTFDFEDDVIQSKTPVLVDFWAPWCPPCRAIAPSLEEISNELEGKLQVIKVDIDQNPELAQRFGVRSIPTLKVF
    VDGKVAKEIVGAMPKQALQAQIAPFVKGE

    >gi|115352029|ref|YP_773868.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MTNKLNGIDVAALQTFAQEVAATTEPAKRSARFNVRTKWENQTRTVATVSRYAIRGEEYQRHFEIAADEPLEFLGQNTAP
    NPQELLMAALNA
    CLSVGYAVNAAAMGITIHSLEIETDGELDLRGVLGLDESVNPGYDEVSYVVRLHTDGTREQVEELHRN
    VTKTSVNYANFSKAIRMVPKLEVLEG

    >gi|115352030|ref|YP_773869.1| DSBA oxidoreductase [Burkholderia ambifaria AMMD]
    MKTVTVEVWSDFVCPWCWIAKKRFEKAVHSVAGQVQVVVTNKAYRLAKGMRPMDYKNALHQKLGGAAGADRMMTAVSTNG
    LLEGLVYNFDTMRFGDTTAAHALVKSISSPVLAQMMSERLYKAVTTDGLDIFDQAVLASLAKEVGVTDMLEFDRVRVASE
    IARDEAEANSIANGVPLFLLNGKTFLSGAREAVVFERALRDAAVDVPGALDETEGESCGIDGCH

    >gi|115352032|ref|YP_773871.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MEKKWTEELKSLVKRVSGFNKTNAPVARAFHALETATREGSVLDAKTHELISLAVAVTTRCDGCIAAHAGAAKKAGATKE
    EIAAALGTAIALNAGAAYVYSSRALEAYEELGA

    >gi|115352114|ref|YP_773953.1| hypothetical protein Bamb_2063 [Burkholderia ambifaria AMMD]
    MAKPHTVVVYGIPNCDTVKKARVWLDDHGVEFEFHDFKKLGVSAPLVEDWLKDVSLDALVNKRGTTWRGLDDAMKAAAET
    RSGAVALMIHKPSVIKRPVLVVNGRVKSLGFVADQYAALFAA

    >gi|115352118|ref|YP_773957.1| glutathione peroxidase [Burkholderia ambifaria AMMD]
    MSTLYSFSAETLAGEPASLDAYRGKVLLIVNTASECGFTPQYAGLQKLYEQYAARGFFVLGFPCNQFGKQEPGDAAQIGA
    FCERNYGVTFPMFAKVDVKGDHAHPLYRYLTDEAPGILGLKAIKWNFTKFLVDRDGRIVKRYAPSTKPEEIAADIDKLL

    >gi|115352212|ref|YP_774051.1| iron-sulfur cluster assembly protein IscA [Burkholderia ambifaria AMMD]
    MKDRGAPQVCRGKDIMAITLTEKAAQHVQKYLVRRGKGVGLRLGVRTTGCSGLAYKLEYVDELAPEDQVFESHGVKVIVD
    PKSLAYIDGTQLDFAREGLNEGFKFNNPNVKDECGCGESFRV

    >gi|115352223|ref|YP_774062.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria AMMD]
    MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTIIAIVEAAA
    TDAAPVKAPEPAKPAAAAPAPAAAAPAAAPQAGSYSGTADIECDMLVLGAGPGGYSAAFRSADLGMKTVLVERYSTLGGV
    CLNVGCIPSKALLHTALVIDEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFVDPYH
    MEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYATLGAEIDVVE
    MMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKTIGADK
    AGVAVTDRGFIDVDKQMRTNVPHIFAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWAGKTE
    DQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGKTIHP
    HPTLGESIGMAAELYEGVCTDLPPQRKK

    >gi|115352404|ref|YP_774243.1| hypothetical protein Bamb_2353 [Burkholderia ambifaria AMMD]
    MTIVNLAAYHFVSIDATEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFIDYIRHDPLFEGKFATLQFKES
    LSDSQPFRRMLVRLKREIITMKKPAIKPELGRAPSVDARTLKAWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDGALDYRI
    DKFSEFPEVIDANRADLEGRTVVSF
    CTGGIRCEKAAIHMKEIGIDNVYQLEGGILKYFEEVGGAHYHGDCFVFDYRTALN
    PQLQPTENVTCFACRAVVTPEAQQSPSYVPGKSCPACAQAASAA

    >gi|115352659|ref|YP_774498.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia ambifaria AMMD]
    MFNAVIDAPFGKVGIRTDAAVVREIVYLPESVKSVEPDSPLARRAVEQIERYFERASARFDLPLADVGSAFQHRVWDVIS
    DIAPGTVLTYGQVAKRIGSAPRAVGQACGANYFPLVIP
    CHRVVAAGGLGGFANHDDNGYYQKVKRWLLAHEGVPYR

    >gi|115352665|ref|YP_774504.1| thioredoxin [Burkholderia ambifaria AMMD]
    MDTTLATFEKDVIEASLDAPVLVDFWAPWCGPCKTLGPLLEKLEADYQGRWKLVKVNVDENQELAAHFQTRSIPHVIAFA
    DGRPVDQFIGVLPEGQLRAFLDRLLPAPEEAERRAAQYAIAESRYDDALTHLEAALALNPGFDDARLDLIELLLANNQVD
    AARTEAERLSPQTVQGADPRYQAIKTRFDALDATADLPPTDALEARIAANPADLDARFDLAQSLIARRAYEGALEQLLEI
    VLRDRAYGDDLGRRTMLSVFEMAGDSPELVAAWRRKLSMALN

    >gi|115352670|ref|YP_774509.1| peptide methionine sulfoxide reductase [Burkholderia ambifaria AMMD]
    MVNEMLETATVGGGCFWCTEAVFLDVDGVTAVQSGYAGGHMRNPGYRDVCEGDTGHAEVVNVTFDPARIGYREILEIFFA
    THDPTQLNRQGNDVGTQYRSVVFTHSDEQRDIALDVIRELEREQVFGQPIVTQVVPLDDNYWPAEDYHQNYYARNPGQGY
    CSVVIGPKLAKFRQKFSHRLKSLRGA

    >gi|115352944|ref|YP_774783.1| electron transport protein SCO1/SenC [Burkholderia ambifaria AMMD]
    MLHSRFGRRARQGWMLTCAFAAATLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTHCP
    DV
    CPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADEAQLKKVTKDFRVYYAKVAG
    KTPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGPWVHDLKLLVD

    >gi|115352961|ref|YP_774800.1| glutaredoxin 3 [Burkholderia ambifaria AMMD]
    MSKVLMYSTQVCPYCIQAERLLKLRGVEQIEKVLIDRDPARRDEMMTRTGRRTVPQIYIGETHVGGYDDLSKLDREGGLL
    PLLQAA

    >gi|115352962|ref|YP_774801.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MTFFTDYTNLALIAILLVSGGLLAWPALRRGRGGLSAAEATQLINRRNAVVIDLRAATDFAAGHLPSARQVAAGEIGAKI
    AQVAKNKSTPVLLV
    CQNGQQSQKAAREVQAAGYAEVHVLEGGVAAWQQAGMPVVKQGVAK

    >gi|115352965|ref|YP_774804.1| UBA/THIF-type NAD/FAD binding protein [Burkholderia ambifaria AMMD]
    MNDDQLLRYSRHILVDEIGIEAQQRFLDAHALVVGAGGLGSPAAMYLAASGVGTITLVDADTVDLTNLQRQILHATASVG
    RSKVESGRDTLARLNPEVTVHAVAARVDDAWLDEHVPRAGVVLDCTDNFATRHAINRACVAHGVPLVSGAALRFDGQIST
    FDFRDPAAPCYACVFPEDQPFEEVA
    CATMGVFAPTVGIIGAMQAAEALRVIGAIGTTLNGRLMMLDSLRMEWTTMKIARQ
    ADCPVCQGRH

    >gi|115352976|ref|YP_774815.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MNTTPPAQRRTGPARYIVAAVVVAAIAVAGFFAFNGKSSVPDATFTLLSGQKVSTAGDLKGKVYLVNFWATSCATCMQEM
    PQMVETYNRFKGQGLEFVAVAMNYDPPMYVANYAQTRQLPFKVALDDGSVAKQFGNVQLTPTTFVVDKNGKILKRYVGAP
    QFAELDALLKKALDGNAA

    >gi|115353021|ref|YP_774860.1| DSBA oxidoreductase [Burkholderia ambifaria AMMD]
    MKKLLSTLLLSLGLAAAGFAQASPAAPVSGKDFEVMKSPQPVSAPAGKVEVIEFFWYGCPHCYEFEPTIEAWVKKQGNNI
    DFKRVPVAFRDDFIPHSKLFYAVSALGISEKVTPAIFNAIHKQKNYLLTPQAQADFLATQGVDKKQFMDAYNSFSVQGQV
    KQSAELLKSYAIDGVPTVVVQGKYKTGPAYTNSIPGTAQVLDYLVKQVQDKKL

    >gi|115353101|ref|YP_774940.1| glutathione-disulfide reductase [Burkholderia ambifaria AMMD]
    MEFDYDLFVIGAGSGGVRLARMSASYGARVGIAEEEQIGGTCVLRGCIPKKLLVYASHYPHELEDAKGFGWTFGAGTLDW
    PALIAAKDREINRLSDIYINLLRQSGVEMHAGRATLVDAHTVAIGDRTIRARHIAIATGSRPSLPPRPGIEHAITSREAL
    SLAKLPERIAVVGGGYIAVEFAGIFNGFGSHVDLFYRGEKILRGFDDDVRHFLTDEMTKQGVAIHARAVVESIVRADDGT
    LFVGVGEAQHGPYDAVLYATGRVPNVEGLGLERAGVLLDARGAIAVDAYSATSVASIHAIGDVTSRPQLTPVATRDGALL
    AATLFGGRRAATDHEWVPSAVFSQPEVATVGLTEAHARAVYGELDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVVG
    AHMVGRDAGEIIQGIAIAIRAGATKAQFDDTIGIHPTAAEEFVTLRQKVAD

    >gi|115353235|ref|YP_775074.1| thioredoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MPALNLDTDADRIAERLADPDTLLVACLCAEWCGTCRDYRTAFDQLADAHPDACFAWIDIETHADRLDDLDVENFPTILI
    EDANTARFFGTVLPHAAIVERMLSDLSAVPGAPHAPKLRNILNVEA

    >gi|115353256|ref|YP_775095.1| AraC family transcriptional regulator [Burkholderia ambifaria AMMD]
    MPMSRVGTIYTRECEVQMKTAYPTDDARWGAVTARDPHADGAFFYGVRTTGVFCRPSCASRLPRREHVSFFADPAAARAA
    GFRPCKRCQPEGLPRELDIVNRACAVLDAHPERLTLQQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALREALQS
    GQPVTQAAVDAGFNSPSRLYASVPRELGMAPSAFRRQGAGLRIDYATASTPLGTVLVAATEQGICRIAFGDEPAPLVDEL
    KDAFARAELVEAPSRLAPFVAQIRAYLDGTRHAFDLPLDIAPTAFQQRVWEALTHIPYGETRSYSEIAEALGSPRAVRAV
    ASACASNPVALAIP
    CHRVVQKGGALAGYRWGVRRKATLLASEARHVRDDETEAVAEGNVV

    >gi|115357984|ref|YP_775122.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MNILYKTSATSTGGRDGRAVSADNKLEVKLAAPRELGGTGAEGTNPEQLFAAGYSACFLSAMKFVAGQNKQTLPADTQVT
    AEVGIGPNDAGGFGLDIELRVSLPGLDKADAQALVDKAHHV
    CPYSNATRNNVPVRLTVV

    >gi|115357997|ref|YP_775135.1| 3-mercaptopyruvate sulfurtransferase [Burkholderia ambifaria AMMD]
    MPHTHYTTLISAANLAERLAAAPGSVAVFDCRFDLADPVAGEAAYAAGHIPGAQYLHLDRDLSGRKTGTNGRHPLPTRDA
    FATLMASRGVKQGQQVVAYDAHGGAYAARLWWLLRWLGHDSIAVLDGGLQAWEAAGQPLTTDVPHPPAGDFRAAAPLEST
    VDAAAVLANVTSAQRVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLNADGRFKTGHELRETFTTLLAGTEPNSV
    ILQ
    CGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSRPIATGPTP

    >gi|115358250|ref|YP_775388.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria AMMD]
    MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIGSLTSRVTVTERRDDAERKPSFSIGEPGKPAGIRFAG
    IPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYAFETYFSLS
    CQNCPEVVQALNVMSLINPRIRHVAIDGALFQ
    NEVEARQIMAVPTMFLNGESFGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
    VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQIRLANGAVLKAKTIILATGA
    RWREINVPGEREYRNRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLP
    NVTIVTQAQTTELTGDGSKLNGLVYKDLRSGEAKRVDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
    AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVTPATADTPQAEEAIAA

    >gi|115358251|ref|YP_775389.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Burkholderia ambifaria AMMD]
    MPIINTQIKPFKATAYHNGEFVPVTEENFKGKWSVVVFYPADFTFVCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHK
    AWHDTSDTIGKIKYPMIGDPTLTLSRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAA
    HPGEVCPAKWTPGAETLTPSLDLIGKI

    >gi|115358282|ref|YP_775420.1| glutathione S-transferase domain-containing protein [Burkholderia ambifaria AMMD]
    MPTLTLISHPLCPFVQRAAIVLLEKQVPFQRINVDLSDKPAWFLEISPTGKVPVLQVQEAGGSNEVLFESVAICEYLQET
    HSGPSLYPDDPLERAKHRAWIEFGSATLAEAWGYLNAKDHFTANVKATSLKDKLAQLEKVLGLGPYFDGETFGMVDAVFA
    PVFRYFDVLQTDSGPSPFPDFPKVDAWRERLRVRASIIAAVSADYPALFRAHLRRQKALLMEEIYGASQPYPATSHKL

    >gi|115358305|ref|YP_775443.1| protein of unknown function DUF395, YeeE/YedE [Burkholderia ambifaria AMMD]
    MLIGLAAAWLIAFNGRIAGISGIVGGLFTAGAAERDWRAAFVAGLIAAPLMMRIAGAAVTPQVDAGWGELLAAGLLVGIG
    TRYAGG
    CTSGHGVCGLSRGATRSIVATAVFMAAGFATVFVRRHVLGG

    >gi|115358434|ref|YP_775572.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MLSSTTSTESDRDIVTQTADSTSRFPVASYQDVRARLLARDELALIDVREEDPYAQGHPLWAANFPLSKLELDAWTRIPR
    RDTPIVVFGEAGGEDLAPRAAATLARLGYTDVRLLDGGLAGWLAAGGELFIDVNVPSKSFGEWVEAERHTPSLSAQEVQA
    LIDAQADVVIVDARRFDEYQTMNIPTSTSVPGAELVLRVRALAPNPQTRVVVN
    CAGRTRSIIGTQSLINAGLPNPVAALR
    NGTIGWTLAGQTLERGASRRFPDDVDPAQRDEARRAARAVAERAGVPRIALADVAALDEPGRTLYRFDVRTPEEYEAGHL
    PGFLSTPGGQLVQETDHHAAVRGARIVLADDDGVRADMTASWLAQMGWDVRVVEPAGTAAFVERGQPPRDVPATPEVSEV
    SPATLAGWLKEAAAGEIAIVDVTTSANYVKRHIPGAWFVVRAQLRDALAAIPPAKRYVFTCGSSLLARFAAHDARALLPA
    SAAISVLTGGTAAWIDAGLPLEHGETHLASPRVDRYRRPYEGTDNAAAAMQAYLDWEYGLVDQLKRDGTHHFRVI

    >gi|115358443|ref|YP_775581.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MQPRLNFYTASPNAIKVMRNAEEFIAKSSIEKPLAELVRLRASQINGCAFCVDMHTTDARKGGETDRRLATVVAWRETPF
    FTERERAALEWTEALTLVADNHVPDSVWEAVKPHFSDTELFDLSMLIATINTWNRFAIAFRKMPE

    >gi|115358528|ref|YP_775666.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MSSRSAPVWHFPITIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWTSMFAAAIGATMLADSLWFFMGR
    TRGRRLLNGLVRFSLSLDTTLRFARNVFERYGAPLLVISKFLPGLGLVSAPLLGTTAIGVGVFLFWDLAGASLWAAVWLV
    GGAAVHDQIVQFVLWVRASGGTILDAFLAIFITFVLYRWVRRVQFRRYLAQLRISPPQLVEMMTSNEPPLIFDARPRAIR
    EREPYRIAGAVPIDLDSPDLLDPELLKRPIVVYCV
    CPNEATAKRLIAKMQRKKMLHNIRALKGGLDAWEKHGYPVEPMPA
    DADASRYFVRPAHAAPLEGEYTVRATLSK

    >gi|115359097|ref|YP_776235.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MSYVTDVPAADSAAALAHFEASLGFETDCWDVHDALASGAPDFVLLDVRSPELFSAGHVPGARNLPHRKIVAGKLAEHPA
    DTLFVVY
    CAGPHCNGAARAAIRLARLGRPVKLMIGGITGWLDEGFALSNDAEPKELAAR

    >gi|115359216|ref|YP_776354.1| methylamine dehydrogenase accessory protein MauD [Burkholderia ambifaria AMMD]
    MMQTALTVSTALLWIAVLALGAICLALVRQIGILYERIMPAGALMIDKGPAVGAIAPTFELTDIRGSRIKVGGIDAAGKA
    TLLFFLSPT
    CPVCKKLLPLLPSLQASESTPVNIVLASDGELDEHTRFAQKHGLARFPYVLSQELGLAYQIGKLPYAVLLD
    DTGTVRAKGLVNTREHLESLFEAKERGVASLQQFVHGDHDHGGHEEHAQHA

    >gi|115359361|ref|YP_776499.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MLPRLKTAALVIALAATAGIAAFAGTRDDAGMTASLAGTPAPDFTGIERWQNSPPLKLAQLRGKVVLVDFWTYSCINCIH
    TIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDPKNVADALKRFDIQYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVY
    TRYGEGGYDKTEAAIREALVQAQAQAGEGTKGAMRTQ

    >gi|115359454|ref|YP_776592.1| selenophosphate synthetase [Burkholderia ambifaria AMMD]
    MPTMTEATLTPPAVPRLTSLSHGGGCGCKIAPGVLSELLKRATPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFM
    PIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLPHETIAAILRGGESVCAEAGIPVAGGHSIDSVEPIYGL
    AAIGVVHPSRVKRNAAARAGDVLVLGKPLGVGVLSAALKKNQLDAAGYAQMVATTTKLNRPGAELAALPGVHALTDVTGF
    GLLGHTLELARGANLTARVHYASLPWLAGVEAFVADGVFTGASGRNWAAYGTDVRLADGLPPVAQALLTDPQTSGGLLVA
    CAPEAVDDVLACFRADGFDRAAVIGEMVDGPSRVDVA

    >gi|115359491|ref|YP_776629.1| uncharacterized peroxidase-related enzyme [Burkholderia ambifaria AMMD]
    MTAANHAPVSRFPVPALDDLPDDIRERIAAVQEKSGFIPNVFLTLAHRPDEFRAFMAYHDALMDKPGNLTKAEREMIVVA
    TSAVNQCQY
    CVIAHGAILRIRAKDPLIADQVATNYRKADITVRQKAMLDFAMKVSQSAHLVGEADFDTLKSHGFTDEDVW
    DIAAISAFFGMSNRIANVTNMRPNAEFYALGR

    >gi|115359559|ref|YP_776697.1| beta-lactamase domain-containing protein [Burkholderia ambifaria AMMD]
    MIFRQLFDPQSSTYTYLLADPASREALLIDPVFEQVRRDAALLDELGLRLVATVDTHVHADHVTGAWLLKQRTGSTIAIS
    AASGAQGADRYLNDGDRCAFGARYLTVRATPGHTSGCISLVLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHARL
    FTLPAACLLYPAHDYRGLTVTSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDALAAA
    DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFAGPLGHLPGATPIPLGELAARTGELARDRPIVTV
    CRAGGRSA
    QATVILLKAGFDAVANLGGGMLRWRGEGRVVMDGRS

    >gi|115359572|ref|YP_776710.1| heavy metal translocating P-type ATPase [Burkholderia ambifaria AMMD]
    MTEPLASAGLQTIELAVDGMHCGGCTGRVQRALAAVPGVVEAAVDLDAQAATVTAQDTVEPAQLVDAVSAAGYRATVREA
    AFETVAAAQAEHAPRAEALPATPAALPAAGAGAGAGAGAGAGATIELEIDGMT
    CASCVSRVEKALAKVPGVTRASVNLAT
    ERATIDAAPDVSASRLAEAVQQAGYGATAVAAPPPAASRDLEFDIGGMT
    CASCAGRVEKALAAVPGVARASVNLATERAS
    VHGAGALDAAALIAAVTTAGYRASLAAAPDAGAVVEVPSSDAAQAPEARKRREAIRERNLVIGSAVLSAPLVVPMLVAPF
    GIDAMLPGWLQLVLASIVQFGFGARFYRAAWHAVKARTGNMDLLVALGTSAAFGLSLWMLVRDPVDPGHLYFEASAVIVT
    LVRFGKWLEARAKRQTTEAIRALNALRPDRARVVEHGVERDVPLGQVRVGTTVSIRPGERVPVDGRIVSGRSHVDESLIT
    GESLPVPKDDGDPVTAGSINGEGALVVETTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSEVFVPAILGIAVLTLIG
    WLIAGAGTETAILNAVAVLVIACPCALGLATPAAIMAGTGVAARHGVLIKDAQALELAQRTTVIAFDKTGTLTEGKPSVT
    AFDAVGIPREQALALAAAVQRQSDHPLARAVVAAHEADVVARGGGAGSADIVAADARAVAGRGVQAHVDGQLLALGSTRW
    RDELGIDVPPELDARAAELEHAGNTISWLMRADAPRALLALIAFGDTVKPGARDAIAALSARGVASVLVTGDNRGSAAAV
    AASLGIGEVHAQVLPDDKARVVAELKRTHGGVVAMVGDGINDAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVAD
    AIDISKRTYRKIQQNLFWAFVYNLIGVPLAALGWLNPVIAGAAMAFSSVSVVTNALLLRRWKGRAR

    >gi|115359601|ref|YP_776739.1| thioredoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MKTVLRNLTAACLFAAAGAAFANPAPQGAAVSSPSGDGAHLPPGIAWQQGDVDAAFALAKRTGKPLLLYWGAVWCPSCNQ
    VKSTIFSQQAFKTRSSFFVPVYLDGDTESAQKLGERFKVHGYPTMILFRPDGTEVTRLPGEADLDRYMQALSLGMTATHP
    VRQTLSTALNNGASLTPDEWHLLADYSWDTDGALPVPPDRVAVTLQTLSQRARAAGAKADAARFALKSAVVAASDDPAQA
    GALDKAALADALRAVLREPVLARADSDVLVAAPARVVAYLGGDAAQRAKLRGAYDAALARLSTDTTLSSIDRLMALHGRV
    LLARGDAHDGAPLPAPALVDAARKQIAASVQGAANPYERQALVSEGADTLTDAGLYDESDVLLKAELPRSATPYYFMSGL
    AANAKARGDKAAVLDWYRKAYDSASGPATKLRWGATYFANAVALAPDDSARIEAIAASVLAQAGKTRDAFYGANLRALTK
    VVTQLNRWRGGGGHDASVRSVVKQFDGVCAKLPADDPQAAACAKLIQPVKA

    >gi|115359605|ref|YP_776743.1| rhodanese domain-containing protein [Burkholderia ambifaria AMMD]
    MLRDLVAQYGPLLVFANVLAAAIGLPVPAMPTLVLFGAMAAMHPAMIGSQLVTVLALSVLGALIGDTVWYVAGRRYGGTT
    LKTICRLSLSRDTCVKKTERFFGRYGVRVLAVARFIPGLSLVSVPMAGALGTRYRTFAGYDALGAALWTIVGLVAGLVFY
    RQIDWLFAGAGRLGRAVLLVIVALLAIYAAVRWMRRRALIRQLASARIGVDELDRLLTDASAPVVLDVRSPEHRKLDPFT
    IPGAQFADERRIDDIVSRYPLTQKFVVYCS
    CPNEVTAALMAKRLLDAGFTDALPLRGGLDAWRDTGRQLTSLVEEVPAAN
    DPVAGLHKPA

    >gi|115359709|ref|YP_776847.1| arsenate reductase [Burkholderia ambifaria AMMD]
    MMITIYHNPRCSKSRETLALVEALNTTGTPVNVVEYLKTPPTVEELDTLHRQLGRPVRDMLRDGEEPYKTLDLARESLAD
    AEAYEAIAAHPILLQRPIVVYRGKAAIGRPPESVRTLFE

    >gi|115359865|ref|YP_777003.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
    MLSIGPFSIRVVAVAAAALIAWLVARFMQRRPPDGQHKSAASLILDTLLLGLIAARVGYVGQWWSEYSAAPRSIVALGDG
    GFDWRIGVAAALVFAGWRLRRLPALRRPVLAGMLAGLAAWGIAQGTLATLQRGAPPLAALRLETLDATPVAPQRFAGKPV
    VVNLWATW
    CPPCQREMPILAQAQQDHPDITVLMVNQGEDAQTVRAFLERKGLRFDHVLLDRTLHTMKAYGSRGLPTTLFF
    DANGNLVESHMGEITAARLKDTVSAGLRP

    >gi|115359888|ref|YP_777026.1| hypothetical protein Bamb_5143 [Burkholderia ambifaria AMMD]
    MDIEQRYTANAPTRAEVDALAGNTVIEFGANWCGICASAQPAIVASLAAHPAVRHLKIEDGPGRPLGRSFRVKLWPTLIF
    MRDGVEVARVVRPADAKQIEAEGFAALA

    >gi|115359975|ref|YP_777113.1| methylated-DNA--protein-cysteine methyltransferase [Burkholderia ambifaria AMMD]
    MTLAHLIPSPLGDIAIRIEDDALTGLFFVGQKYYPSLAIAPKADARNVPPLARKVADEVADYFTGTRETFSVPIHLRGTA
    FQRSVWKELLAIPFGELVSYGDITERVGLPMSAARAVGGAVGRNPVSIMVP
    CHRVIGASGSLTGYAGGIERKRALLSLEG
    AGFAPGERHPVQQTLGF

    >gi|115360048|ref|YP_777186.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria AMMD]
    MQNHHEVIVIGGSFAGLSAAMQLARARRRVLVIDAGRPRNRFAEHAHGFFGQDGKPPARIVADAAAQLAAYPTVQRIAGE
    ARTAERDARGRFHVTLADGSRASADRLILATGIRDALPALPGLAERWGVSVLH
    CPYCHGYEVSDRQLGVLATHPLSVHQA
    ILIPDWGPTTWFTQGLVEPNEEEAALLDARGVRIERSPVVEILGDAPRIEALRLADGQVVPIDALFIGARTEMASDLAQQ
    LGCAFDEGPLGVAVRVETWKQTSVPGVFAAGDASSLMTNATFASASGVAAGVGAHRSLIFGLDA

    >gi|115360056|ref|YP_777194.1| uncharacterized peroxidase-related enzyme [Burkholderia ambifaria AMMD]
    MTTTAHGFTSDTLGWRAWLDTVALDAATPDQLAVLEASHPHAKTSDYYLLLVHLPEILRQRSGVFNAIMYGPGGLSRAER
    ELASTAVSRVNGCVY
    CASVHAQRFTQLAKRTDAIEQVFDDPATAGTTARERAIVRYAIALTERPDTVDASDIAELEAEGL
    THEDILDLSHAVAIFAWANRLMLTLGEPVFPEPAAHA

    >gi|115360133|ref|YP_777271.1| mercuric reductase [Burkholderia ambifaria AMMD]
    MTQQFDAIVIGTGQAGPPLAARLAGAGMKVAIVERGRFGGTCVNTGCIPTKTLIASAYAAQLARRAEEYGVSVGPVSVDM
    KAVKARKDRISGRSNHGVEQWVRGLDNTTVFQGHARFERADAVRVGDELLEAKRIFINVGGRAQIPQMPGLDSVPYLTNS
    TMMDVDFLPEHLVIIGGSYVGLEFGQMYRRFGSKVTIVEKGSRLIHREDEDVSQAVREILENEGIDVQLDANCLNARRDG
    DGVVVGLDCAGGGREVAGSHLLLAVGRVPNTGDLGLDQAGVATDSRGYITVDDQLRTNVPGIWALGDCNGRGAFTHTAYN
    DYEIVAANLLDSDPRKVSDRIAAYAMYVDPPLGRVGMTLAEAKQTGRRLLVGTRPMTRVGRAVEKGESQGFMKVIVDADS
    HAILGASILGVTGDEVVHALLDVMAAGAPYTTISRAMHIHPTVSELVPTLLQDLHPVE

    >gi|115360268|ref|YP_777406.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MPLIHAAATLAADAPNYVVQLQAGTHALTGDEAPREGGQGLGPAPFEFVLAGLAQCTAATLRMYMQRKTWPAVRIDVHTE
    LHADREGQQYVRRTVTLEGPLDDAQRQRLAEICEKTPVTLFIKRGTRIETTLS

    >gi|115360405|ref|YP_777542.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Burkholderia ambifaria AMMD]
    MSASDASSSRPDLAQGIALDDIADGAMIEGRVGDATVLLVRRADELFAVTGQCPHYGAPLADGLLVGDTIRCPWHHAAFC
    LRTGAMLRAPALDGLTCWRVERRDGRAVVLDAQPAASPPALKTAGLPESVVIVGGGAAAIAAAVTLRREGYPHAITLLSA
    DSEPPYDRPNLSKDYLAGTAEADWLPLRGASFYTEQRIDVRCGTRVTRIDPAAHAVELADGSRVGYGALLLATGAEPNRL
    TVPGAELPHVRVLRSRAD
    CDALIGTLKNAQRCVVVGASFIGLEAAAALRTRGLVVQVVAPDAHPMARVLGDALGDTLRAL
    HESHGVTFHLGVTPAQITPDDVMLSNGDGLPADVVVVGIGVHPDVTLAQDAGLAVDRGVTVDRFLQTSAPDIYAAGDIAR
    WPDPLTGERIRVEHWVVAERQGIAAARNMLGQQRPFDAVPFFWTQHYDLTVRYVGHAEQWDRVEIDGDLRAHDGSVTYWR
    GDKRLAVATIGRDLDCLKAEEALEQQGAAGSR

    >gi|115360477|ref|YP_777614.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MNHETKILYTGEVRTTGGRDGAAHSADGRLDVKLSAPGSAAPGTNPEQLLAAGWSACFIGAMGLAAQKLKVSLPRDTHVD
    AQIDLATNNGAYFLQARLNVSVPGVDADVAQALVDAAHQT
    CPYSKATRGNIDVVVTVA

    >gi|115360533|ref|YP_777670.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MNDNKLQAPPLSLLDRYRGREFQPLYTTSVTVSGGETGHGRASGVVRSDDGNLAVDLRLPAEFGGPGNGTNPEQLFAAGF
    AACFHGALNLLTQRADIEPADTVVEVRVSFGRDPMDGGHALLIDVQVRMPGVDRSIAEELVRAAERL
    CPYAKMARQGTVN
    IVTVVD

    >gi|115360537|ref|YP_777674.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MENERLQPPPLTLLDKYRGREFAPLYTTTVTVSGGEAGHGRASGVARSDDGCLVLDLRLPTELGGPGGGTNPEQLLAAGY
    AACFHGALSLLAQRDRIDIRDATVAVEVTFGRDPMDGGYALIANVTVRMPGIDRQVAERLVRDTERL
    CPYTKMARQGICN
    ILAVSA

    >gi|115360538|ref|YP_777675.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MTQRINYFQQSPEFTKKLVELDGLFQKTTIEVPVRELVEIRASQLNGCAFCVDMHVKAARIHGERELRMHHVAIWRESTL
    FSPRERAALAWTEALTHLQSDGVPDELYERVRTHYSEKELSDLTFLVGAINCWNRLNVAFRIVPGSFDKTFGLDKANLE

    >gi|115360697|ref|YP_777834.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MSIEKVLYRAHAKATGGRDGRATVPESGLDLKLTTPRELGGAGGVGANPEQLFAAGYSACFIGAMKFVAARDKIAIPADA
    AIEGSVGIGAIPNGFGIEVELKISLPGLDRETAQTLIDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|115360700|ref|YP_777837.1| methionine-R-sulfoxide reductase [Burkholderia ambifaria AMMD]
    MPTRRHLLFAGVTGLATLAALSSAGRRALVGRAFAAPPAAPFEITRSDAEWRRRLTPAQYTVLRNAGTEPPYSSPLNAEH
    RRGTFACAGCDLALFSSDTKFDSHTGWPSFWKPLDHAVATETDPSYGMARTEVHCRRCGGHLGHVFDDGPPPTGLRY
    CMN
    GLALAFHPAAA

    >gi|115360701|ref|YP_777838.1| cytochrome c biogenesis protein, transmembrane region [Burkholderia ambifaria AMMD]
    MLLIVLAYLGGVLTILSPCILPVLPFVFARADQPFVRTGLPLLIGMALTFAVVATLAAVGGGWVAQANQAGRWLAIVLLA
    VFGLTLLLPRFAEHLTRPLVAAGNRLTGFAQRDGRPAGPLSSLLLGVATGLLWAPCAGPILGLVLTGAALRGASVGTTAL
    LVAYAAGAATSLGVALVIGGKVFAAMKRSLGAGEWIRRGIGVALLAGVGAIALGLDTGALAQLSTVTTGSLETKLVDRLG
    GRSNGAPAAMSSTSNIGSGDNAGSGTASGAMMAAATDGAPAAGSAMMRTAGTTPAMQAAALPVEGTLPSLDGAVQWLNSP
    PLTAAGLRGKVVLVDFWTYS
    CINCLRTLPYTTAWAHKYAPYGLVVIGVHAPEFAFERDIGNVKKAVHDLGIDYPVAIDNG
    YAIWRAFGNEYWPAHYFVDAQGRIRHHHFGEGEYAQSERAIQSLLAEAGHPEALNVPLGLTGAPAKGALAAADSADVRSP
    ETYVGYARAEDFTSPGGVVRDASHRYDAPAHPDLNDWGLAGTWQVGAERATLAAPAGRIVYRFHARDLHLVLGPGANGKP
    VRFRVTLDGAAPGAAHGADVDAQGYGTVTGQRLYQLVRQPGTIADRTFSIEFLDPGVDAYAFTFG

    >gi|115360702|ref|YP_777839.1| methionine sulfoxide reductase A [Burkholderia ambifaria AMMD]
    MIPTSTRRSAPKRAAMLRRIGAIALAAAAVFGYQRVVSSAEPMRTVPAPTLDETPGTSHEETAVIAGGCFWGVQGVFEHV
    KGVKQVTAGYAGGASETAHYALVGSGLTGHAESVRIVFDPTQVTYGRLLQVFFSVAHDPTELNRQGPDEGSQYRSAIFPT
    TAQQRAVATAYIAQLGTAHTFASPVVTRVEPYKGFYPAEAYHQNYLELHPDAPYIAYNDMPKVAGLKQRFPALYRPDAVL
    WRDAHL

    >gi|115361125|ref|YP_778262.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MSKRLDYNQIAPAGVKALGGVYGYVMQSGLSPVLVDLVYLRVSQINNCAYCLDMHTRDLLKKGVKVEKLALVQAWREAGN
    LFDERERAALAWAESVTLVAATGVPDDAYEAARAVFDEREIVDLTIAVSLMNTYNRMAISFRNTPQAVLEQ

    >gi|115361179|ref|YP_778316.1| glutathione-disulfide reductase [Burkholderia ambifaria AMMD]
    MKRYDYIAIGGGSGGIASVNRAAMHGKKCALIEAKEIGGTCVNVGCVPKKVMWYAAHIADAIRHYSSDYGFNAEIERFDW
    ATLVKNRSAYIDRIHASYETSLDRNKVDVIAGFGRFVDTRVVEVDGERMTADHILIATGCRPSRPDIPGAEHGIDSDGFF
    ALREMPARTAIIGGGYIAVELAGVLNALGSQTHLFVRKNTPMRHLDPLLSDTLVEVMKSDGPTLHTHAIPKAIHKNPDGS
    LTLQLEGGESYIADCIVWAIGREPHTDDLNIRATGVAIDDRGYVIVDKYQNTTVPGIYAVGDITGLLDLTPVAVAAGRRL
    SERLFNNKPHEHLDYNNVPTVVFSHPPIGTVGLTEPEARMKYGDDGVKVYQATFTSMYSAVTRHRQPARMKLVCVGPDER
    IVGIHGIGSGMDEILQGFAVALKMGATKRDFDNTVAIHPTAAEEFVTMR

    >gi|115361184|ref|YP_778321.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MAEQRFDFHGAHGTLLSGRLESPQTTPRGWAIFAHCFTCGKDSVAAARIARALALSGIGVLRFDFAGLGGSEGEFANSTF
    AADVDDLVAAGRAMAASGRAPSLLIGHSLGGAAALAAAADMPSVQAVATIGAPSSVEHVLGLFGSDSLAQIEADGEAEVL
    LAGRPFTFRKSFLDDARQQKLEDRIAHMHKPLLVMHAPGDRIVDIQHATRIFVAAHHPKSFVSLDDADHLLTRRPDSDYV
    ASVVAAWAVRYLPAVAADIPDISEGDGVLAEETGKGLFQLAMRSGKHQFLADEPESVGGMASGLSPYEFVCAALAA
    CTVM
    TMRMYARRKGIPLVRASTRVTHSKRPDQTPADLFARTISLEGPLDDEQRQKLLAIADRCPVDLTLVRGSDVSTTLEAESE
    KLVIQSND

    >gi|115361187|ref|YP_778324.1| alkylhydroperoxidase [Burkholderia ambifaria AMMD]
    MMQDWNSYRDNLLERVGDYAKQSPEVVRGLMTIDNAAAKTGHLEAKMHELIALAVAVTTRCDGCISVHTKKAVEAGASLE
    EISEALGVAIALNAGAALTYSARVIETYQQLPNK

    >gi|115361194|ref|YP_778331.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MKMNGIDLVALGAMADKAKNSGENATAKFKVKTKWMGQAKTVGVVSEYVLFDETFDRHFDISADEPRELLGENSAPNPQE
    LLMAALNA
    CMSVGFAANAAAMGIKLDKLEIETVGELDLRGFLGIDPAVKPGYEEVHYTVRVKSDASREQLEELHRAVVKT
    SPNFSNFSTAIKMVPEFIIENL

    >gi|115361244|ref|YP_778381.1| dihydrolipoamide dehydrogenase [Burkholderia ambifaria AMMD]
    MCLIEVKVPDIGDFSGVDVIEVNVKPGDMIEKEQTLITLESDKASMEVPSDVAGTVKEVKVKAGEKVSQGTIIAIVETAA
    SDAAPAKAPEAAKPGAAAPAPAAAAPAAAPAPAPQAGSYSGAADIECDMLVLGAGPGGYSAAFRSADLGMKTVLVERYST
    LGGV
    CLNVGCIPSKALLHTALVIDEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGTFV
    DPYHMEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVIGGGIIGLEMATVYATLGAEI
    DVVEMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVGAEAKEDGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKTI
    GADKAGVAVTDRGFIDVDKQMRTNVPHIFAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWA
    GKTEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGDLISEVCLAVEMGADAEDIGK
    TIHPHPTLGESVGMAAELYEGVCTDLPPPRKA

    >gi|115350625|ref|YP_772464.1| OsmC family protein [Burkholderia ambifaria AMMD]
    MECKVSWMGQDGMAFSAQTGSGHLVAMDGAPEGGGHNLAPRPMEMVLVGTGGCTAYDVVLILKKSRQEVTGCSVTLKAER
    ASEDPKVFTKVHFHFTVTGRNLNPATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAD