Acidovorax citrulli AAC00 1 uid58429

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|120608722|ref|YP_968400.1| OsmC family protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MSEKTASVHWQGAGKTGQGQISTETGALKSYPYGFGSRFGDDRTGTNPEEIVGAAHAACFTMAFAFACEKAGIATETLDT
    TARVRLAKEGEGFKIDRIALTLKAKVPGIDDAKFQEIAAGAKAN
    CPLSKALAGVPEITLDAQLVG

    >gi|120608746|ref|YP_968424.1| heavy metal transport/detoxification protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MQHSFQVQGMTCGHCERAVVHAVRSVDTDASVQVDLPTGRVVVESDSPREALAAAITEEGYTVAA

    >gi|120608747|ref|YP_968425.1| heavy metal translocating P-type ATPase [Acidovorax avenae subsp. citrulli AAC00-1]
    MADSPSPLLSFPDASTATLPEQSLDLGIGGMTCASCSGRVERALRKVPGVRSAEVNLATERAHVVYAAAPDGAVASMEGL
    LRRAVRNAGYEPRAADAPEPPDAASPWAGFGPVAAGIALSLPLVLPMLGGLAGRDWMPPAWLQWLLATPVQFVLGARFYR
    AGWHALRARAGNMDLLVAIGTSAAYGLSLWLWFTAAHGSEGHAPHLYFEASAVVITLVLLGKWLEARAKRQTTEAIRALH
    ALRPEAAHWIGPDGEVDVPVAELMAGDRIAVRPGERLPVDGTVLEGHTQVDESMLTGEPLPVARGPSDAVTGGSINGDGR
    VVVRVTAVGAETVLARIIRLVEDAQAAKAPIQRLVDRVSAVFVPAVLVLALCTLLGWLAAGAGLEAALIHAVAVLVIACP
    CALGLATPAAIMAGTGVAARHGILIKDAEALETAHRVDTVVFDKTGTLTLGQPRLQAFEAAPGCDAGALLATAAALQAGS
    AHPLAHATLQAVRERGLSLPAAADAVQAVPGRGTEGQVQGTSWRMGSLRWMDALGADVPPALAARARALQDGGATVSALA
    ERLPGGGDAVRALLAFGDEPKPGAAAAVQALRARGLRVVMLSGDNRGAAEAMARRLGLRPGAGEVIAEVLPADKAAQVVR
    LQRDGRQGPGSPGARTVAMVGDGVNDAPALAAADVGIAMGNGTDVAMHAAGITLMRGDTALVAAALDVSRRTVAKIRQNL
    FWAFAYNVAGIPLAALGYLSPVVAGAAMALSSVSVMANALLLKRWRL

    >gi|120608953|ref|YP_968631.1| glutathione peroxidase [Acidovorax avenae subsp. citrulli AAC00-1]
    MTSAYDFDALQMDGQAVPLRQYAGRVLLIVNTASACGFTPQFAGLQELHQRYADRGLVVLGFPCNQFGRQDPGSNGEIAA
    FCQRNYGVDFPMMAKIDVNGSGAPPLYRWLTAEAPGLLGTKAIKWNFTKFLIGRDGQVVRRYAPTAKPASLAGDIEAELA
    RPAP

    >gi|120608962|ref|YP_968640.1| glutathione S-transferase domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MTPALTLYYAPGTCAQAVRIALCEAGAEHRLVRLDFPAGEQRSPEYLAVNPKGRVPALVTEEGTLTETPALLAYVAQRFP
    QARLAPTDAHGFARMQEFHSYLASTVHVAHAHRPRAVRWADEPEAIAAMQRKVPQNMTECFELIEQHSLGDGPWVMGDQY
    TVADGYLFTVAGWLASDGVDIARFPKVHAHSQRVAARPAVQRALT

    >gi|120609051|ref|YP_968729.1| redoxin domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MIKIGEALPAVTLMEYSEVEGGGCSIGPNPVDVAKASAGKTIALFAVPGAFTPTCSAKHVPGYVEQAEAFKAAGVDEIWC
    LSVNDAFVMGAWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIEAPGKFEVSDAD
    TLLAQARG

    >gi|120609053|ref|YP_968731.1| redoxin domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MMGLKHWIGAAAVAAFVGVGAFVFLGAGRSQAPDSTFVLLDGSRQTTADLRGKVTLVNFWATSCTTCVAEMPQIVSTYGK
    YRDRGFETLAVAMSYDPPSYVVNFAQTRQLPFKVAIDNTGTVAKAWGDVRLTPSTFIVNKRGEIVKSYVGAPDFAELHQL
    IERLLAET

    >gi|120609119|ref|YP_968797.1| DSBA oxidoreductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MKRREFSLSAATAVAASAVTLPVATPAFAQARQFKEGKDYTRLAKPAPTDAPAGKVEVIEFFWYSCPHCNAFEPTLEAWI
    KSAPKDLVVRRVPVAFNSSFAAQQKLYFALEGMGKLPEVHAKVFRAVHVEKLPLNKDDQIFDWIGKQGLDVAKFKEVYNS
    FTVSNQLRKAAQLQDAYGVEGVPAMGVAGRFYTDGTMAGSMQNVLQVVEYLAGVARKG

    >gi|120609203|ref|YP_968881.1| hypothetical protein Aave_0501 [Acidovorax avenae subsp. citrulli AAC00-1]
    MRPTITRLLRWRTALSYIEWPIAAAAILLAAALAIAIWPEHPQVPSSEPQPAQPAPPMPPGPPWTHGRSDARFTITIYAD
    LE
    CPYCRDYVPQLVRWVAATPDVSLQWHHLPLQAHEPAASQEARLAECAGNERGHAGFWHTVDWIYAHTSAEGRGVPDGT
    SYPDMTPQMQACVSSEESKTTVSRQAQQAAADGITGTPTLRLRDRTSGKEMHLSGAVPADALMSALDLLASPVPGR

    >gi|120609550|ref|YP_969228.1| redoxin domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MTDPTPAAGAAVSSDAAPASPPRRRALYAAAAAVAAAGGAGLAWWRFQPHAAASGAEAALWGMRFDVPQPGSPALDMQVF
    RGRPLLVNFWATW
    CPPCVEELPMLNTFYRAQQAKGWQVVGLAIDQPSSVRQFLARVPLDFPIGLAGLQGTDLGRSLGNLA
    GGLPFTVLLGADGTIMHRKMGQITADDLRQWSTMG

    >gi|120609578|ref|YP_969256.1| putative thiol:disulphide interchange protein (periplasmic) [Acidovorax avenae subsp. citrulli AAC00-1]
    MKLIPALLAGAAALTLGLGAHAQESAIRKALGSRIPQLQNIDEVRATPMQGLYEVRIGTDVFYTDAKGNYLIQGELIDTK
    ARRNLTEDRINKLTAVDFASLPFQDAFTIVRGNGQRKLAVFEDPN
    CGYCKRFEKDLQNVDNVTVYLFLYPILSPDSAEKS
    RNIWCSKDRAAAWQDHMVRDKTTPAASCDTAAVQRNLAFGKKHKITGTPTLIFTDGSRVPGAIDAREVEKRLADAGSGAG
    PAPATN

    >gi|120609609|ref|YP_969287.1| arsenate reductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MTDATPDPDVTIYHNARCSNSRGALALLREHGIEPRIVDYLAEPLDEAALRTLFSQVGGPVRALLRPKEPAWQALGLDDE
    AIGDEALIAHVARHPELMNRPIVVTPRGARLCRPPETVLELLPAG

    >gi|120609770|ref|YP_969448.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MAADMAAGDGTGPEGGTSDFDSDVLVIGGGPAGLTAALYLARFRRSVVLVDAGDSRVAKIPRSHNYPGFVDGIPGHSLLE
    TLRAQMRRYPIRTVRAAIERIERVAPAEGASGPAEGQGQGQGFFHAHWRGGGSVRAPFVLLATGVEDIPPPMPHVRQALE
    DGLLRY
    CPVCDAYEAIGQGIGVIAEGAHGVGEAIYLRHFSADVTLFLAPGDTVLSGDDRERLVRAGIRWVQAPVDAIRRE
    GDRVVVHHAGGSSACDTLYCALGLQIHAGLAAGLGAALDASGYVVVDAHGATTVPGLYAAGDVAQGLNQIAVAAGGAAIA
    SSAIHVALGPSSGT

    >gi|120609922|ref|YP_969600.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidovorax avenae subsp. citrulli AAC00-1]
    MAIVVNKPLPEFEANATGGIKVSNTSHLGQILILYFYPKDNTPGCTTEAMQFRDKYEDFAQAGAAVFGVSRDNMKSHDDF
    KEKLELPFELIADTEEKMCHMFGVVKNKIMYGKKVKGIERSTFLIGPDGVLVQEWRGLKVPGHVDEVLKAVKSIKALKKA
    A

    >gi|120610062|ref|YP_969740.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidovorax avenae subsp. citrulli AAC00-1]
    MSLINTQVQPFKTEAFVNRNGKGEFITVTEENLKGKWSVLIFMPAAFTFNCPTEIEDAADNYAEFQKAGAEVYIVTTDTH
    FSHKVWHETSDAVGKAKFPLVGDPTHQLTNAFGVHIPEEGLALRGTFVINPDGVIKTMEIHSNEIARDVSETLRKLKAAQ
    FTAANPGQVCPAKWKEGAKTLTPSLDLVGKI

    >gi|120610063|ref|YP_969741.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MLDDQLKSQLSAYLERVTQSFEIVASLDGSDTSAQMRDLLETIQSLRSDRISLRTDGTDARKPSFTLQRAGTQTSLRFAG
    LPLGHEFTSLVLALLWTGGHPPKVEQDVIEQVQALDGDFDFEVYMSLT
    CHNCPDVVQALSLMAILNPRIRTTVIEGGAFQ
    QEVTDREIMAVPMVFLNGQVFGSGRMTIEEIVGKLDTGAAKREAAKLSAKEAFDVLIVGGGPAGAAAAVYAARKGIRIGV
    AAERFGGQVNDTLDIENYISVSKTDGPKFAAALEQHVRDYEVDLMNLQRARALKPAATEGGLIEVELENGGTLSSRTVII
    STGARWRNMNVPGEEQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVAHVTVLEFAGELKADAVLQRKL
    RSLPNVDVILNAQTTEVKGDGTRVTGLSYKDRTNDEHHVLALEGIFVQIGLLPNTDWLKGTVDLSRFGEIVVDSHGRTSV
    PGVFAAGDCTTVPYKQIIIAAGEGAKAALGAFDHLIRTTAPA

    >gi|120610206|ref|YP_969884.1| heavy metal translocating P-type ATPase [Acidovorax avenae subsp. citrulli AAC00-1]
    MCPGGWAHSLGAMLSDPSESPAASSAIDREALPGSPSVDGDALLDDPQEWPSFGRPHASATGPAQGVWDSHVVLQGMHCA
    ACALTIEDALRAVPGVLQAEVSAATHRARVVWDAGVVRPSRWFAAVARAGYPALPAMDALAREQRRREGRRALWRWLVAG
    FCMMQVMMYAWPAYVAQPGDLTAEMERLLRWASWVITLPMMIFSCGPFFSSALRDLRQRRVSMDLPVALGMGITFVVSTA
    GTFDPAGPFGREVYYDSLTMFVFFLLTGRWLEMRLRDRTAGALEAVMNRLPDSVERRGADGTFTRVGVRRLAAGDVVRVL
    PGEAFPADGRIDRGSTQVDEALLTGESTPLPRAEGAAVTAGSYNLSAPVEVRVERVGGDTRFAEIVALMEAASAQKPRLA
    QLADRIARPFLVGVLLAAGLAAAWWWRADPEHALMVAVAVLIVTCPCALSLATPVAMLTAAGALARQGVLVRNLQALETL
    AAVDTVVFDKTGTLTRDGVRIAGVHPAPGFEPADALALAAALARHSLHPLSRALVEAAGPQGQGAAARWRVSDVREVAGQ
    GLVARVDDGEGRLAPAVVRLGRAADSVPVDAQQLALCAQPLHGSAGDRGGAASPAGWPAEIARFGWREDLRSDAAGVIVR
    LRGAGLAVELLSGDRDDAVARVAAGAGIEVARGGCAPQGKLDHMRALQAAGRHVAMVGDGLNDGPVLAGAHVSFAFGRAV
    PLARSRSDFVVMGEQLAMVERSVRLARRTLRVVRQNLAWAAAYNALCVPLAVAGWMPAWLAGLGMALSSLLVVANAARLA
    RGAGSDAETAAMAPDAAVPPDAAPLVQGAA

    >gi|120610276|ref|YP_969954.1| OsmC family protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MATHTATVAWQRGTDDFLDRRYHRAHTWQFDGGATVAASSSPHVVPLPCSDAAAVDPEEAYIAALSSCHMLWFMDFASRA
    GLRLDSYTDTATGTMAKNEAGQIAVTHVRLRPVTRFDAAHAPGAEQLEALHRQAHAS
    CFLANSVRTQIDCEPVLEITGN

    >gi|120610539|ref|YP_970217.1| arsenate reductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MIGRMSTPTPIVYGIPNCDTVKKARAWLAEHGVEYRFHDFKKQGVPAERLAAWMASLGWEPLVNRQGTTWRKLDPQAQAA
    VSDAASAAALLQAQPSAIKRPVVEWTGDAGGEVTVGFQDARWNERLAAASKR

    >gi|120610690|ref|YP_970368.1| 3-mercaptopyruvate sulfurtransferase [Acidovorax avenae subsp. citrulli AAC00-1]
    MAYTTLISADELKALRASGTPLMVFDCSFDLAHPSRGHQQYLESHIPGAVYAHLDESLSARHGAPGAGGTIVATEGDMPV
    SGGRHPLPHPERFAAWLSSVGFSNAMQAVVYDRNGANFCGRLWWMLQWVGHEAVAVLDGGLQAWEQAGGELAHGEEPAHF
    QANFALGEPLQRLATAAEVQAALGQPGQTVVDARAPARYRGEVEPLDPVAGHIPGALNRPFSDNLGPDGRFKPAAQLRAE
    FESLLAGRDPSTVVHQ
    CGSGVSATPNVLAMQVAGLGRTALFAGSWSEWCGDPSRPVERG

    >gi|120611104|ref|YP_970782.1| dihydrolipoamide dehydrogenase [Acidovorax avenae subsp. citrulli AAC00-1]
    MSDTLDVIILGAGSAGLAALREVRKRTERVLIVNDGPWGTTCARVGCMPSKMLIEAADAFHRRHSFDTFGIRGGRSLGLD
    LPAVLDRVRALRDDFVAGTRKASDIGAQGIAGHARLMGPHRVEVDGRVYDTRSIIIATGSRPIVPEEWLAFGDRILTTDT
    LFEQRDLGPRMAIIGLGPLGAEIAQALARLGVEVAAFSSRKEIAGLSDPAVNDALLGLLKSEFVLNVGAEVTLREVPGGI
    EVTNGSATVVVDQVLAAMGRRPNVEHLGLETLGVELDKDGMPPVDRRTVQVGDLPVFMAGDANDFRPLLHEAADDGHIAG
    LNALAPEVRGFRRRMPLSIVFTEPNAATVGRRYKDLKRDESVTGTVDFARQGRARVAQRNQGRLSLYAQRDTGRLLGAEM
    CAPAGEHMAHLLALAMDRELTVHDLLRMPFYHPVLEEGLRSALRDAASQLPKGSDSDLSACDAYGSSALD

    >gi|120611116|ref|YP_970794.1| iron-sulfur cluster assembly protein IscA [Acidovorax avenae subsp. citrulli AAC00-1]
    MAITLTEAAARHVSRYLSRRGKGLGVRLGVKTTGCSGLAYKLEYVDEPEPEDVIFEDHGVKVLIDPKSLAYIDGTQLDFV
    REGLNEGFRFNNPNERDRCGCGESFRV

    >gi|120611128|ref|YP_970806.1| glutaredoxin [Acidovorax avenae subsp. citrulli AAC00-1]
    MPSLPPAVRLAALCLASAAAALPATAQNVYRIVGPDGKVTFSDRAPDAQSGPATVNGKPVGTSASGLPYELQQVASRFPV
    TLYTGND
    CAPCTSARNLLTSRGVPFTERTVNTNEDAEALQRLSGSTALPFATIGSQQLSGFSDTEWTQYLDAAAYPKQSQ
    LPPNYRRPPATPLVSAKPATPAPAAPPAAPPAPVQRPAAPPAPSPANPAGIQF

    >gi|120611135|ref|YP_970813.1| dihydrolipoamide dehydrogenase [Acidovorax avenae subsp. citrulli AAC00-1]
    MAVIDIKVPDIGDFSEVGVIEVLVKAGDTIKVEQSLITVESDKASMEIPSSHAGVVKEVKVKVGDKVAEGSVVLTLEAAD
    AAAAAAPAPASAPAAAAAPAQAAAPAPKAAAAPAPAAASFGGNADVECDVLVLGGGPGGYSAAFRAADLGLKVVIVERYS
    TLGGV
    CLNVGCIPSKALLHVAAVIDEVSHLKAAGIEFGAPKVDIDTLRGHKEKVIGKLTGGLAAMAKMRKVTTVRGVGQF
    VGANHLEVEETTGARGQEKTGGKKVVAFKRAIIAAGSQAVHLPFMPNDPRVVDSTGALELKEVPKRMLILGGGIIGLEMG
    TVYSTLGARLDVVEMMDGLMQGADRDLVKVWQKMNAHRFDNIMLKTKTVGAEATPEGIKVTFAAAEEGGKAPEPQVYDLV
    LQAVGRTPNGKKIGAEKAGVAVTDRGFIDVDVQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGELTGDKALAS
    AAFNARVIPSVAYTDPEVAWVGLTEDQAKAQGIKVRKGLFPWTASGRAIANGRDEGYTKLLFDDSPEAHGHGRILGGGIV
    GTHAGDMIGEIALAIEMGADAVDIGKTIHPHPTLGESIGMAAEIAHGSCTDVPPQKK

    >gi|120611218|ref|YP_970896.1| disulphide bond formation protein DsbB [Acidovorax avenae subsp. citrulli AAC00-1]
    MVSNWLDAAPRRVLALISAACIAMLAFGMYLQHVVGLEPCPMCIVQRYALIGVAVFTGLGSLRGGRGWWMTWGVLALLLS
    GFGAFVAARQSWLQWYPPEIAT
    CGRDFYGMIENFPISRAIPMIFRGSGDCAAIDWTFLGGSIANWSFVCFVVMALVLLVM
    LLRAPRPARGGFSAA

    >gi|120611219|ref|YP_970897.1| rhodanese domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MSQILTAALYHFAKLPDCDALRGPLQAECDRHGVRGLLLLAPEGVNGTIAGKAEGVRAVLAMLRAQPPLAALRHKEAWGD
    RMPFYRMRVRVKREIVTLGVPGVDAARDAGTYVKPGDWNALIDDPEVVVIDVRNGYESAIGSFARAVRPETRSFTEFPAW
    VEAQTAPGGLLAGKPRVAMFCTGGIRCEKSTALLRMQGFGEVYHLEGGILQYLEDVPAEGSRWEGDCFVFDERVSVSHGL
    VPGTHRHLCRSCRMPLGPQDLASPDYLPGVRCPHCRGTRPAEEERALAERERQMALARQRGTEHLGARLPAPSRAGPVAD
    SAARDHAPEPGEAEASLPVLYSFRR
    CPYAIRARMAIAASGLRCEWREVVLRDKPAALLAASPKGTVPVLVLPGGQVLEQS
    LDIMRWALAQRDPEGWLQAGEPDEVEALIASCDGTFKQALDRCKYPERHPELPPGAAQSQARAWLVGLEDRLARSAYLCG
    SRAALSDVALMPFVRQYAGIDRTDWDARPWPRLQAWLAAWESGALFEQVMHKAPAWRDGQAVQYFPPGPCPAERS

    >gi|120611242|ref|YP_970920.1| glutathione S-transferase domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MKLYYAPGTCSLAPHIALREAGLPFTLARVDLSTHTLASGEDYRQINPKGQVPALELDDGTRLTEGPVIVQFIADYAANT
    AFMPASGSLDRYRVMAWQNYITAELHKSFSPLFNPDFDAAAKDLHRRLLRGKYDWIDEQLSPGPFLTGSAFTAADAYLFV
    VTKWARHVELDLSDLRALADFMSRVAGRPAVRSAMQAEGLPG

    >gi|120611307|ref|YP_970985.1| thioredoxin [Acidovorax avenae subsp. citrulli AAC00-1]
    MASELIKHISDASFEADVLQPGTTVLVDYWAEWCGPCKMIAPILDEVAGSYQGKLTVAKMNVDENREVPAKFGIRGIPTL
    MLFKDGQLAATKVGAMSKAQLTSFIDQQLA

    >gi|120611323|ref|YP_971001.1| thioredoxin domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MPYTAQHLAEAPAREDIDRLQGAAVLEFGTPWCGYCQRAQPLIEAALKDHDHVQHIKVEDGPGRPLGRSFGVKLWPTLVF
    LRDGKEIDRVVRPQDATALHPGMQAIAHAPAISIGPA

    >gi|120611394|ref|YP_971072.1| disulfide bond isomerase [Acidovorax avenae subsp. citrulli AAC00-1]
    MPTPSPILRAAVAALAVMAAQHADAEVSEKIAARLKAAIAANTGGSVRVDQINSTPIKGIYEVLSDNELFYTDDTGRYSF
    VGSSLIDTVERRDLTAEKLDRRMTIPFDQLPLQHAIKEVRGDGSHVFAVFEDPN
    CPICRVFTKFIDQIDNVTVYRFIFPV
    ISPQSQSLARMAWCSDDRPRTWKSMMDGARPRLPETCDTAGLVEILRTGERFQINNTPTVVLASGKRLVGATPPEQFLAE
    LDKGGRAAARGVPR

    >gi|120611478|ref|YP_971156.1| peptide methionine sulfoxide reductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MDSETITLGGGCFWCTEAVFDRVRGVTDVESGYANGQVPHPTYEQVCSGRTGHAEVVRLTFDPGVIGLREILEIFFATHD
    PTTLNRQGNDVGTQYRSGIYTATPAQQELAEAMVRQMSQDRLFGAPIVTEVQPLQSYWPAEDYHQDYYLNHPEQGYCAFV
    AGPKVEKFRKTFARYLKPE

    >gi|120611481|ref|YP_971159.1| rhodanese domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MIDHVRPSQLDEWFSAQAGGGRPLVLDVREPWELQTASVRAAEGGGFDIAAIPMGEIPARLDDLDAERPVACLCHHGVRS
    LRVAAFLEQHGFQRLANISGGIDAWSHERDPGVPRY

    >gi|120611488|ref|YP_971166.1| methylated-DNA--protein-cysteine methyltransferase [Acidovorax avenae subsp. citrulli AAC00-1]
    MPLAPSSRPALVQMRIASPLGDMRLAASAAGLAGIWFDGQRHQPTDRLDGPGAWQHDPSHPVLVATASQLREYLEGRRSR
    FDVPLDLTVGTAFQRDVWQALVEIPHGAVTSYAALARALGRPLAVRAVGAAVGRNPVSVIVP
    CHRVLGSDGTLTGYAGGL
    PRKTALLRLEGALADRLRTLPLWPQGDATARGTGAPRTGAAA

    >gi|120611610|ref|YP_971288.1| hypothetical protein Aave_2947 [Acidovorax avenae subsp. citrulli AAC00-1]
    MAGMTTSAPSAPTAEARSGLTWRDGFAALGPDFFTELVPTPLPGPRWVAGSEATARLIGLEPDWLGSDAAVQVLSGNALL
    RGMRPLASVYSGHQFGVWAGQLGDGRAILLGETDTGYEVQLKGSGRTPYSRMGDGRAVLRSSIREFLCSEAMHALGIPTT
    RALALTASPAPVVREEIETAAVVTRVAPSFVRFGHFEHFAARDQVRELRALADYVIDRYYPGCRDAGGAPGANPYAALLQ
    AVGARTAALLAQWQAVGFCHGVMNTDNMSILGLTIDYGPFQFLDAFVPGHICNHSDSQGRYAFNRQPQVAYWNLFCLGQA
    LMPLIGDTELAQAALEPYRTAFPAEYMARMRAKLGLVSAAEGDAALVDDLLGLLAADAVDYTIFWHRLSQAVASGDFTPV
    RDLFIDRAGWEAWSARYRQRLGSGSDQAAGLMERTNPRFVLRNHLGEQTIRAAKSGDFAPLHALQAVLARPFDEHPAHAE
    WAGFPPDWASSIEIS
    CSS

    >gi|120611611|ref|YP_971289.1| methionine-R-sulfoxide reductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MTYPIQKTDAEWQALLQDKGAEPAAWQVTRHAATERPFTGKYEAHWADGSYHCVCCGAKLFDSDTKFDAGCGWPSFSLAV
    PGAIREIVDRSHGMVRTETVCAQCGAHLGHVFEDGPAPTGLRY
    CMNSASLDFEPGGA

    >gi|120611793|ref|YP_971471.1| uncharacterized peroxidase-related enzyme [Acidovorax avenae subsp. citrulli AAC00-1]
    MSRYPLPELNTLPGDIQARILEVQDKAGFIPNVFLAFARRPAEWRAFFAYHDALMLKEEGSLTKGDREMIVTATSAANQC
    LY
    CVVAHGALLRIYEKKPFVADQVAVNHRKADITPRQRAMLDFAMKVCQQSQAIGEDDFTALHAHGFDDEDIWDIAAITA
    FFGLSNRMASFAGMQPNPEFYLMGRVPRQR

    >gi|120611870|ref|YP_971548.1| 3-mercaptopyruvate sulfurtransferase [Acidovorax avenae subsp. citrulli AAC00-1]
    MNAAGARQQPEDIPMAYDTLISAAELAAAREAGTPLLVLDCSFELSSHDAGRQAYDAGHIPGARYVHLEHVLSAEKTGTN
    GRHPLPGREAFAQAMASLGAQDDTQVVAYDNAGGMYAARLWWMLRWAGHRAAAVLDGGMAAWKAAGQPVSTEEPAPPSAG
    RFTLRTPLVSTLDYEDVKANIGTGRRLVLDARAPDRFRGENETMDPIGGHIPGAKNRLFKDNLGADGRFKPAAQLRGEFD
    AVTGGRPAAEIVHQ
    CGSGVTACHNLLAMEVAGLPGAALYPGSWSEWSAQPGAPIATGAA

    >gi|120611904|ref|YP_971582.1| dihydrolipoamide dehydrogenase [Acidovorax avenae subsp. citrulli AAC00-1]
    MSKQFDVIVIGGGPGGYIAAIRAAQLGFNVACIDEWKNEKGGPAPGGTCTNVGCIPSKALLQSSEHFEHANKHFAEHGIT
    ATDVKIDVAKMIGRKDAVVKQNNDGILYLFKKNKVSFFHGRGSFVKAAEGGYEIQVAGAAQETLVGKQIIVATGSNPRAL
    PGVPFDEEKVLSNDGALRIGATPKKLGLIGAGVIGLEMGSVWRRVGADVTVLEGLPTFLGAVDEQIAKEAKKAFDKQGLK
    IELGVKIGEIKTGGEGVTVAYTDAKGEARELAVDKLIVSIGRVPNTIGLNPEAVGLQLDERGAIVVDADCRTNLPGVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVIYTSPEIAWVGRTEQQLKADGVQYKAGTFPFLANGRARALG
    DTTGMVKFLADAVTDEILGVHIVGPMASELISEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|120611983|ref|YP_971661.1| glutathione S-transferase domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MKLYHEVRGCSLAVDIVARELRLPLDLEWVNMKTKRLQDGTDYLRINSKGTVPTLQLPDGQHLSEGCVITQYLADQCPGN
    TLLPAAGLARYRVLEWMSFVAADLHKGGFMPLFKTVTPPEYKAIARGYLQARLGWLDSQLDGRDYLTGSTFTLADAHCYT
    IAMWTRAHAIDTGGWPHLEAYLARCGGRPAVLAAEAAAAAQGERERAAAAR

    >gi|120611991|ref|YP_971669.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MRYDTIIVGGSYAGIAAALQLVRARRSVLVIDAGQRRNRFASHSHGFLGQDGVPPEDIAANARRQLAAYPSLSWLEGRAT
    AVTGSADAFTVTTSDGGSHRARRILLATGVADRLPAVAGLAERWGTAVFH
    CPYCHGYELGQGRIGIVGASPLSVHQAELL
    TDWGDVTLLVNRALDLTDTSRSTLAQRGVAIEEAPIDRIEGHADVVMADGRQLRFAGLFTATRTSPSSPLAEAMGCVLED
    TPMGTQVRTDAENKTSVAGVFACGDVARIPHSLSLAVGHGAMAGAQVHRSLVWPETLAPQPVEDRMR

    >gi|120612040|ref|YP_971718.1| hypothetical protein Aave_3386 [Acidovorax avenae subsp. citrulli AAC00-1]
    MPDTISPPAPPSAGGPPTAPGWWVVCLCAAWCGVCREYGAVFEALRAAHPEVRFEWVDVEDEEDLAGDLDVETFPTVLVA
    DGTHARFLGPVLPQAGVLARMLAALREEGDAPPVDAQAQAVFERIRQARAAAGS

    >gi|120612080|ref|YP_971758.1| thioredoxin reductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MSTTQHAKVMILGSGPAGYTAAVYAARANLNPVLITGIAQGGQLMTTTEVDNWPADVNGVQGPELMQRFLEHAERFKTQV
    VFDHINQVDLSKRPFTLTGDSGTYTCDALIIATGASAKYLGLPSEEAFMGRGVSG
    CATCDGFFYREQDVCVVGGGNTAVE
    EALYLSNIARKVTLVHRRDKFKAEPILVDKLNEKVAAGKIELKVFHTLDEVLGNDSGVTGIRIRSTQDGSTQDIALQGCF
    IAIGHAPNTGIFEGQLTLENGYIVTQGGLKGFATQTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQEGVI

    >gi|120612337|ref|YP_972015.1| glutathione S-transferase domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVDRARVRLFLLNFEKELFVHVNVLESRATKGNEKALEKARSHIRDRLTQLAPVFLKNKYMLGENFSMLDVAIAPLL
    WRLDYYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|120612497|ref|YP_972175.1| glutaredoxin 3 [Acidovorax avenae subsp. citrulli AAC00-1]
    MQPVKMYTTAVCPYCIRAKQILKAKGVEQIEEIRVDLDPEARSHMMEVTGRRTVPQIFIGDTHVGGHDDLVALDGRGGLM
    PLLGA

    >gi|120612498|ref|YP_972176.1| rhodanese domain-containing protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MNFIIDNWYLVLVALVSGTMLLLPVFREAAGGSLTAARAVQLINREKAVVVDVSEPDEFAAGHVGGAKSVPLGQLEERLP
    QVVRNKSVPLVLV
    CAKGARAQRAVVVARKLGYEKAEALAGGLKAWREAGMPVEKA

    >gi|120612501|ref|YP_972179.1| UBA/THIF-type NAD/FAD binding protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MNDDQLLRYSRHILLDEIGIEGQERLLAAHALVIGAGGLGSPAALFLASAGVGRLTLVDADTVDLTNLQRQIAHTTERVG
    QPKVASAAHAVRAINPGVQVDGLPLRADAAWLDAHVPLADVVLDCSDNYATRQAVNAACVRHRVPLVAGAAIRFDGQITV
    IDPRASDAPCYACLFPPDAAFEEVR
    CSTMGVFAPMVGIVGAMQAAEALKLLCGAGKPLAGRLLMLDGLSMEWTTMRAHRD
    PSCPVCGSGGT

    >gi|120612537|ref|YP_972215.1| electron transport protein SCO1/SenC [Acidovorax avenae subsp. citrulli AAC00-1]
    MPMHKRTLLRSAAACALFAGAAGLLGGCSQEKAPSFQGVDITGAEYARDLPLPDHNGQPRHLKDFAGKVVVVFFGYTQCP
    DV
    CPTSMAELAEVKRSLGADGDRLQGLFVTVDPERDTPEVLKAYMTNFDPGFLALRGTPEQLAAVAKDFKIYYKKVPGKT
    PTSYTMDHSAGSYIYDPAGRLRVYHRYGSGAQALASDVKALLQAPGA

    >gi|120612625|ref|YP_972303.1| DSBA oxidoreductase [Acidovorax avenae subsp. citrulli AAC00-1]
    MTAAVPPPSSPAAPLRIDFVSDISCPWCAIGLQSLGQALEALDGTVQAEVHFQPFELNPGMPPGGQDIGEHLAEKYGASA
    EQTAQTQRAIAERGAALGFEFRMDRRGRIYNTFDAHRLLHWAHEVAGPQAQEALKRALFHAYFTEGRDPGDRALLVELAA
    GAGLDAARAQQVLDAGEYADAVRERESFYQQHGIHSVPAVIVNGRHLIQGGQPPEVFEQALRQIAAGG

    >gi|120612686|ref|YP_972364.1| iron-sulfur cluster insertion protein ErpA [Acidovorax avenae subsp. citrulli AAC00-1]
    MSAVAENIQTEMPAPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSV

    >gi|120612845|ref|YP_972523.1| thioredoxin [Acidovorax avenae subsp. citrulli AAC00-1]
    MPESLHIVCPHCHTTNRIAADRLAAPPGTVEADCGQCHRPLFTGEPVALDDASFGRHTERSHIPVVVDFWAPWCGPCRTM
    APAFAQAARALEPGVRLAKLDTEAHPAIGARLGIRSIPTMVMFRQGREVARISGAMGAADIARWVRTAGGA

    >gi|120612908|ref|YP_972586.1| OsmC family protein [Acidovorax avenae subsp. citrulli AAC00-1]
    MTTLDKVLYTARAHTTGGRDGASRSDDGRLDVKLSSPGTSGTGTNPEQLFAAGYSACFIGAMKAVAGKVGVTIPQDLAID
    AEVDLGQIPNAYGIAVRLKVSLPGVDKAKAQELVDAAHQV
    CPYSNATRGNIDVTITLA

    >gi|120613092|ref|YP_972770.1| cytochrome c biogenesis protein, transmembrane region [Acidovorax avenae subsp. citrulli AAC00-1]
    MSVRLLQRLLPSFALLAACALGAPASAQLLSEPAAGISGGTPAGSSTVTTPHVRAELVAHAPDGVGPGKPLWLGLSITHQ
    PEWHTYWKNPGDSGLPTQIEWRQLPPGIDAGEIAWPVPRKIPIGTLANYGYEGTVLLPVPMTVSGAFSPGPLARNATFTL
    HASWLVCRKECIPEEGTFTLQVPIASTTAMQAQDFEAARQAHPQPLSLPAAAAAGGTRSHARVDRGMLVLTVAGLPEAVR
    GKPMDFFPETPGIIETADDGTQDWQGDVWTARMPLSAQRSEGPMSLPVVLAQGGRGWRAELPVEGGWPRPASLATVSPAL
    EAALRANAQQAAQALPAAATPAPAGALAAALLGALLGGLVLNLMPCVFPVLAIKVAGFARHGQDRRAHRLGGIAYTAGVV
    LSFLALGGAMLALRAAGEAVGWGFQLQSPAVVAVLAALFTLIGLNLSGMFEFGRMLPSSLAGLQARHPAADAFLTGVLAV
    AVASPCTAPFMGASVGLTATLPAAQALAVFAALGVGLALPYLAASWVPAVARALPRPGAWMDTLRRFLAFPMFATVVWLV
    WVLGQQSGIDGAAALLALLVALGMVVWAFTLAGRARMAMAPLSLVVFAALAMAAVPKITEMAPPAMAFAAPGTSGAAGTA
    PNAAAWQAWRPGLAEELLAQGRPVFVDYTAAW
    CVTCQFNKKTTLSSDAVLREFAGRNVALLRADWTRRDPAITAALAQLG
    RSGVPVYVLQAPGRRPVVFSEILGERELRTALAAL

    >gi|120613139|ref|YP_972817.1| uncharacterized peroxidase-related enzyme [Acidovorax avenae subsp. citrulli AAC00-1]
    MTDTAATTATASRDTIDHIAGLAPGSTAHAVRHQRDKVATATQGCEDALFGPGLPGGLTQAERLAVAHDIARVSGLPALA
    AHYRAALQPLHPSPAVQALVDAPDAAIADARLQAIVHFARTLATHPAESDQAALQALPAAGLSVPDTVLLAQLIGFVTYQ
    LRVVAGVAALAQLGEAGAAPAAAAAAQPVDAAPFVHPANLPAPGEPLRVNGYTSETLDWKAWLPVLDPAAATPEQNAVLD
    LSHPKARTSDFYLLLAHQPRVLSERSQAFNAIMYAPGGLARAEREVASTVVSRVNGCVY
    CASVHAQRFEQLAKRNDVMAQ
    IFQEPDTAGTNARERAIVQASAALTRTPGTFGAQHLQPLRDAGLSDLEILDALHAAALFAWANRLMLNLGEAVFPRAG

    >gi|120613194|ref|YP_972872.1| thioredoxin [Acidovorax avenae subsp. citrulli AAC00-1]
    MIDVTVENFEAEVIAASMEVPVLVDFWAPWCGPCKSLGPVLEKLEIEYAGRFKLVKIDSDQEQQIAAMFGIRSIPTCVLL
    MNGQPVDGFMGAQSEGQVRAFLDKHVPTADELLAEAEEEAAQEALEDGDTDTALEKLQHAVATDPANDDARFDYVKLLLQ
    LGRVDDAKVAFAPVIAKAAGSRRLGALKVWMDAIDATENARDDAAAEAAFAQKIGANKRDFDARFERARRLIARQRWTDA
    MDELLEILMRDKAWNDEAARKTYVAVLEIIEPPRAKVAEGQIPPEDPVVATYRRRLSSVVLS

    >gi|120613298|ref|YP_972976.1| glutathione peroxidase [Acidovorax avenae subsp. citrulli AAC00-1]
    MPRLTAPLILALAASSAVLPAASQSTPAAPAEPAKPAPACPATLRHTMPRLQDEAPQDLCQYRGQVLLVVNTASYCGFTG
    QYEGLEALHARYKTQGFAVLGFPSNDFAQETGSNAQIADFCSNTFGVRFPMFAKSSVKGGGASPFYRELAAQAGEAPRWN
    FHKYLLDRKGRVVASFGSSVAPDDPKIVRAVEQQLKLFR